top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TBPL1-6:1 | BRCA-Luminal A | 12 | 0.035982 | noncoding | 41 | chr6 | 134177992 | 134183848 | + | 0.9989 | lnc-TBPL1-6 | 0.243 | 0 | -3.257 | -3.743 | 48 | noncoding | -0.401168631 | LILYSSMMSGKK | n[145]LILYSSM[147]MSGKK | LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL |
lnc-TBPL1-6:1 | BRCA-Basal-like | 12 | 0.035982 | noncoding | 41 | chr6 | 134177992 | 134183848 | + | 0.9989 | lnc-TBPL1-6 | 0.243 | 0 | -3.257 | -3.743 | 48 | noncoding | -0.401168631 | LILYSSMMSGKK | n[145]LILYSSM[147]MSGKK | LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL |
lnc-TBPL1-6:1 | BRCA-HER2-enriched | 12 | 0.035982 | noncoding | 41 | chr6 | 134177992 | 134183848 | + | 0.9989 | lnc-TBPL1-6 | 0.243 | 0 | -3.257 | -3.743 | 48 | noncoding | -0.401168631 | LILYSSMMSGKK | n[145]LILYSSM[147]MSGKK | LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL |
lnc-TBPL1-6:1 | OV | 12 | 0.035982 | noncoding | 41 | chr6 | 134177992 | 134183848 | + | 0.9916 | lnc-TBPL1-6 | 0.243 | 0 | -3.257 | -3.743 | 4 | noncoding | -0.401168631 | LILYSSMMSGKK | n[145]LILYSSM[147]M[147]SGKK | LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL |
lnc-TBPL1-6:1 | OV | 12 | 0.035982 | noncoding | 41 | chr6 | 134177992 | 134183848 | + | 0.9916 | lnc-TBPL1-6 | 0.243 | 0 | -3.257 | -3.743 | 4 | noncoding | -0.401168631 | LILYSSMMSGKK | n[145]LILYSSMMSGKK | LILYSSMMSGKKNKPRRNFWRPRTTLLAWFPIIMSHTQLIL |
Page 1 of 1
bottom of page