top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SNHG21:18 | CCRC | 7 | 0.0204656 | noncoding | 60 | chr15 | 82744222 | 82750289 | + | 0.9997 | SNHG21 | 0.605 | 0 | 0 | 0 | 31 | noncoding | -0.369252633 | MSQAGLK | n[230]MSQAGLK | LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL |
SNHG21:18 | CCRC | 7 | 0.0204656 | noncoding | 60 | chr15 | 82744222 | 82750289 | + | 0.9997 | SNHG21 | 0.605 | 0 | 0 | 0 | 31 | noncoding | -0.369252633 | MSQAGLK | n[230]M[147]SQAGLK | LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL |
SNHG21:18 | HCC | 7 | 0.0204656 | noncoding | 60 | chr15 | 82744222 | 82750289 | + | 0.9975 | SNHG21 | 0.605 | 0 | 0 | 0 | 13 | noncoding | -0.369252633 | MSQAGLK | n[230]MSQAGLK | LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL |
SNHG21:18 | LUAD | 7 | 0.0204656 | noncoding | 60 | chr15 | 82744222 | 82750289 | + | 0.9999 | SNHG21 | 0.605 | 0 | 0 | 0 | 28 | noncoding | -0.369252633 | MSQAGLK | n[230]MSQAGLK | LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL |
SNHG21:18 | LUAD | 7 | 0.0204656 | noncoding | 60 | chr15 | 82744222 | 82750289 | + | 0.9999 | SNHG21 | 0.605 | 0 | 0 | 0 | 28 | noncoding | -0.369252633 | MSQAGLK | n[230]M[147]SQAGLK | LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL |
Page 1 of 1
bottom of page