top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TESC-1:1 | OV | 7 | 0.110477 | noncoding | 111 | chr12 | 116977441 | 116987337 | - | 0.6711 | lnc-TESC-1 | 1 | -2.687 | -3.303 | -3.661 | 2 | noncoding | -0.332091253 | MKIHSVK | n[145]M[147]KIHSVK | MKIHSVKGQRCPDHMPKSSKPASRTRSRRAGGSVNIRGTLLILGPSSASCGSITKDSRTRLISQTWEHCHCHSGAYMDKTKLAWLFGPGVPFPRILRAFCGNLSLKVKNNS |
lnc-TESC-3:1 | CCRC | 8 | 0.0918273 | noncoding | 119 | chr12 | 117031149 | 117032846 | - | 0.9953 | lnc-TESC-3 | 0.063 | 0 | 0 | 0 | 11 | noncoding | -0.347165826 | VVVITGTR | n[230]VVVITGTR | LPFLFLRRSLALSPRLECSGAISAHCNLCLLAASDSPASASRVVVITGTRHQAWLIFVFLVEMGFCHVGQAGLELLTSGDTPASVSQSAGITGLSHLAQPKLVSLYLILLKVVVSKKTY |
lnc-TESPA1-2:2 | BRCA-Luminal A | 13 | 0.00518779 | noncoding | 56 | chr12 | 54900816 | 54901088 | - | 0.9992 | lnc-TESPA1-2 | 0.136 | 0 | 0 | 0 | 1 | noncoding | -0.340468851 | LSAPCLQRWSLQR | n[145]LSAPCLQRWSLQR | LSAPCLQRWSLQRQAGLLELWWAPPSSSFPATLFTYSSLSNGRPPSLSLAATLQFD |
lnc-TET2-3:1 | BRCA-Basal-like | 11 | 0.0900518 | noncoding | 40 | chr4 | 104556959 | 104568877 | + | 0.7358 | lnc-TET2-3 | 0.199 | 0 | 0 | 0 | 3 | noncoding | -0.364907638 | VLLLLPRLECK | n[145]VLLLLPRLECK | LELSCMRVLLLLPRLECKGTISAHCNLCFLSSSDPPASAS |
lnc-TET2-3:1 | BRCA-Luminal B | 11 | 0.0900518 | noncoding | 40 | chr4 | 104556959 | 104568877 | + | 0.7358 | lnc-TET2-3 | 0.199 | 0 | 0 | 0 | 3 | noncoding | -0.364907638 | VLLLLPRLECK | n[145]VLLLLPRLECK | LELSCMRVLLLLPRLECKGTISAHCNLCFLSSSDPPASAS |
Page 1 of 1
bottom of page