top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TES-1:1 | BRCA-Luminal B | 7 | 0.0359152 | noncoding | 42 | chr7 | 115789728 | 115791049 | + | 0.9974 | lnc-TES-1 | 0.407 | -4.947 | -4.943 | -4.045 | 41 | noncoding | -0.307696675 | SFHIAGK | n[145]SFHIAGK | LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE |
lnc-TES-1:1 | BRCA-HER2-enriched | 7 | 0.0359152 | noncoding | 42 | chr7 | 115789728 | 115791049 | + | 0.9974 | lnc-TES-1 | 0.407 | -4.947 | -4.943 | -4.045 | 41 | noncoding | -0.307696675 | SFHIAGK | n[145]SFHIAGK | LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE |
lnc-TES-1:1 | BRCA-Basal-like | 7 | 0.0359152 | noncoding | 42 | chr7 | 115789728 | 115791049 | + | 0.9974 | lnc-TES-1 | 0.407 | -4.947 | -4.943 | -4.045 | 41 | noncoding | -0.307696675 | SFHIAGK | n[145]SFHIAGK | LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE |
lnc-TES-1:1 | BRCA-Luminal A | 7 | 0.0359152 | noncoding | 42 | chr7 | 115789728 | 115791049 | + | 0.9974 | lnc-TES-1 | 0.407 | -4.947 | -4.943 | -4.045 | 41 | noncoding | -0.307696675 | SFHIAGK | n[145]SFHIAGK | LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE |
lnc-TES-1:1 | EOGC | 24 | 0.0359152 | noncoding | 42 | chr7 | 115789728 | 115791049 | + | 0.1204 | lnc-TES-1 | 0.407 | -4.947 | -4.943 | -4.045 | 1 | noncoding | -0.307696675 | LTQQEGESGICVESKMLMFGCAEK | n[145]LTQQEGESGICVESKM[147]LM[147]FGCAEK | LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE |
Page 1 of 1
bottom of page