top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TFCP2L1-1:2 | OV | 13 | 0.0180146 | noncoding | 59 | chr2 | 121137741 | 121183774 | - | 0.5467 | lnc-TFCP2L1-1 | 0.091 | -4.749 | -1.879 | -4.83 | 1 | noncoding | -0.361197803 | LSPWYNGETGAKK | n[145]LSPWYNGETGAKK | LLTGWLVGGGRFCRNSVPLYVPSLWQELGIKLSPWYNGETGAKKKINRERLAVGSHFRR |
lnc-TFCP2L1-7:1 | OV | 8 | 0.0839803 | noncoding | 71 | chr2 | 120902275 | 120911781 | - | 0.9968 | lnc-TFCP2L1-7 | 0.036 | -4.982 | -5.24 | -4.924 | 1 | noncoding | -0.312966591 | LSFLAHVK | n[145]LSFLAHVK | LSFLAHVKSPQSPARFISSWSSSLWILGEEHIWAQQERGAEQQQPRAGSTKGFGKAACHLAVTTQMLLCVV |
lnc-TFCP2L1-7:2 | OV | 12 | 0.240185 | noncoding | 64 | chr2 | 120902275 | 120911781 | - | 0.8212 | lnc-TFCP2L1-7 | 0.067 | -4.265 | -4.634 | -4.472 | 3 | noncoding | -0.312966591 | EMGPTAPAMAGR | n[145]EMGPTAPAM[147]AGR | MPQGDQGWDMTAKRRKPQHRKTEGTQREMGPTAPAMAGRRLTPPPAGPTRRSCSYGFSHRSLME |
lnc-TFCP2L1-7:2 | OV | 12 | 0.240185 | noncoding | 64 | chr2 | 120902275 | 120911781 | - | 0.3629 | lnc-TFCP2L1-7 | 0.067 | -4.265 | -4.634 | -4.472 | 2 | noncoding | -0.312966591 | PQGDQGWDMTAK | n[145]PQGDQGWDM[147]TAK | MPQGDQGWDMTAKRRKPQHRKTEGTQREMGPTAPAMAGRRLTPPPAGPTRRSCSYGFSHRSLME |
lnc-TFCP2L1-7:2 | OV | 12 | 0.240185 | noncoding | 64 | chr2 | 120902275 | 120911781 | - | 0.3629 | lnc-TFCP2L1-7 | 0.067 | -4.265 | -4.634 | -4.472 | 2 | noncoding | -0.312966591 | PQGDQGWDMTAK | n[145]PQGDQGWDMTAK | MPQGDQGWDMTAKRRKPQHRKTEGTQREMGPTAPAMAGRRLTPPPAGPTRRSCSYGFSHRSLME |
Page 1 of 1
bottom of page