top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMEM230-4:1 | BRCA-Luminal A | 25 | 0.0201578 | noncoding | 51 | chr20 | 5045760 | 5046276 | - | 0.9956 | lnc-TMEM230-4 | 0.27 | 0 | -4.43 | 0 | 29 | noncoding | -0.470818501 | MIMWFLSVIQLLLCITLTDSGIDFK | n[145]M[147]IM[147]WFLSVIQLLLCITLTDSGIDFK | LTKMIMWFLSVIQLLLCITLTDSGIDFKAFIPPNTLPGLGLLPLHVFRKKT |
lnc-TMEM230-4:1 | BRCA-Basal-like | 25 | 0.0201578 | noncoding | 51 | chr20 | 5045760 | 5046276 | - | 0.9956 | lnc-TMEM230-4 | 0.27 | 0 | -4.43 | 0 | 29 | noncoding | -0.470818501 | MIMWFLSVIQLLLCITLTDSGIDFK | n[145]M[147]IM[147]WFLSVIQLLLCITLTDSGIDFK | LTKMIMWFLSVIQLLLCITLTDSGIDFKAFIPPNTLPGLGLLPLHVFRKKT |
lnc-TMEM230-4:1 | BRCA-Luminal B | 25 | 0.0201578 | noncoding | 51 | chr20 | 5045760 | 5046276 | - | 0.9956 | lnc-TMEM230-4 | 0.27 | 0 | -4.43 | 0 | 29 | noncoding | -0.470818501 | MIMWFLSVIQLLLCITLTDSGIDFK | n[145]M[147]IM[147]WFLSVIQLLLCITLTDSGIDFK | LTKMIMWFLSVIQLLLCITLTDSGIDFKAFIPPNTLPGLGLLPLHVFRKKT |
lnc-TMEM230-4:1 | BRCA-HER2-enriched | 25 | 0.0201578 | noncoding | 51 | chr20 | 5045760 | 5046276 | - | 0.9956 | lnc-TMEM230-4 | 0.27 | 0 | -4.43 | 0 | 29 | noncoding | -0.470818501 | MIMWFLSVIQLLLCITLTDSGIDFK | n[145]M[147]IM[147]WFLSVIQLLLCITLTDSGIDFK | LTKMIMWFLSVIQLLLCITLTDSGIDFKAFIPPNTLPGLGLLPLHVFRKKT |
lnc-TMEM231-3:1 | OV | 7 | 0.0131367 | noncoding | 49 | chr16 | 75563699 | 75566221 | - | 0.9954 | lnc-TMEM231-3 | 0.345 | -4.668 | -5.626 | -3.349 | 2 | noncoding | -0.361578318 | LGAHYGR | n[145]LGAHYGR | LGSIARSGDRLGAHYGRGGCLRTLLEAALRTTRRSVLGTAVVGCLGPRN |
Page 1 of 1
bottom of page