top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMEM183A-5:4 | BRCA-Basal-like | 10 | 0.169377 | noncoding | 33 | chr1 | 202861753 | 202867308 | + | 1 | lnc-TMEM183A-5 | 0.045 | -4.546 | -5.251 | -5.66 | 28 | noncoding | -0.343961864 | SIHILFPFSK | n[145]SIHILFPFSK | MLLVHYFFPVVVSYCSMLKSIHILFPFSKLFLS |
lnc-TMEM183A-5:4 | BRCA-Luminal B | 10 | 0.169377 | noncoding | 33 | chr1 | 202861753 | 202867308 | + | 1 | lnc-TMEM183A-5 | 0.045 | -4.546 | -5.251 | -5.66 | 28 | noncoding | -0.343961864 | SIHILFPFSK | n[145]SIHILFPFSK | MLLVHYFFPVVVSYCSMLKSIHILFPFSKLFLS |
lnc-TMEM183A-5:4 | BRCA-HER2-enriched | 10 | 0.169377 | noncoding | 33 | chr1 | 202861753 | 202867308 | + | 1 | lnc-TMEM183A-5 | 0.045 | -4.546 | -5.251 | -5.66 | 28 | noncoding | -0.343961864 | SIHILFPFSK | n[145]SIHILFPFSK | MLLVHYFFPVVVSYCSMLKSIHILFPFSKLFLS |
lnc-TMEM183A-5:4 | BRCA-Luminal A | 10 | 0.169377 | noncoding | 33 | chr1 | 202861753 | 202867308 | + | 1 | lnc-TMEM183A-5 | 0.045 | -4.546 | -5.251 | -5.66 | 28 | noncoding | -0.343961864 | SIHILFPFSK | n[145]SIHILFPFSK | MLLVHYFFPVVVSYCSMLKSIHILFPFSKLFLS |
lnc-TMEM184C-2:1 | OV | 9 | 0.0886021 | noncoding | 33 | chr4 | 147486828 | 147492655 | + | 0.6994 | lnc-TMEM184C-2 | 0.118 | 0 | 0 | 0 | 1 | noncoding | -0.347185701 | YILHSGEVK | n[145]YILHSGEVK | MYILHSGEVKAFRVSITKIIYIVPTMKFLIIHS |
Page 1 of 1
bottom of page