top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SPACA6P-AS:1 | OV | 24 | 0.110983 | noncoding | 38 | chr19 | 51685362 | 51693456 | - | 0.98 | SPACA6P-AS | 0.02 | -5.893 | -1.303 | -4.904 | 7 | noncoding | -0.261127919 | YVMELEIQTQASLAPSLGWACSGK | n[145]YVMELEIQTQASLAPSLGWACSGK | LNSELPKLTKYVMELEIQTQASLAPSLGWACSGKICYF |
SPACA6P-AS:1 | PRAD | 25 | 0.110983 | noncoding | 45 | chr19 | 51685362 | 51693456 | - | 0.7524 | SPACA6P-AS | 0.211 | -4.095 | -4.295 | -3.455 | 16 | noncoding | -0.261127919 | LQLPESGPGTDGAGVAFNGELGGRR | LLGTGGREQEPVGGKQVGKLQLPESGPGTDGAGVAFNGELGGRRG | |
SPACA6P-AS:1 | PRAD | 26 | 0.110983 | noncoding | 45 | chr19 | 51685362 | 51693456 | - | 0.1082 | SPACA6P-AS | 0.211 | -4.095 | -4.295 | -3.455 | 1 | noncoding | -0.261127919 | LQLPESGPGTDGAGVAFNGELGGRRG | LLGTGGREQEPVGGKQVGKLQLPESGPGTDGAGVAFNGELGGRRG | |
SPART-AS1:10 | CRC | 14 | 0.0260446 | noncoding | 41 | chr13 | 36346431 | 36368410 | + | 0.7504 | SPART-AS1 | 0.129 | -5.334 | -4.622 | -5.829 | 2 | noncoding | -0.384435876 | LPKPGINELPNEHK | LPKPGINELPNEHKQIWKAFEEEGPLKKVQKECIEIMFIHH | |
SPATA3-AS1:1 | OV | 7 | 0.122229 | noncoding | 83 | chr2 | 230985924 | 230996048 | - | 0.4699 | SPATA3-AS1 | 0.345 | 0 | 0 | 0 | 1 | noncoding | -0.329390804 | GGICQQK | n[145]GGICQQK | LSWDTKSGRLQERGRKMIPALRWAGPAPSVEDLKTKIDPHPSPPTSSSPWKRKTFLRGGICQQKALGLELQHQLFLVPQRPGL |
Page 1 of 1
bottom of page