top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMEM8B-1:2 | EOGC | 7 | 0.447245 | noncoding | 43 | chr9 | 35858737 | 35865518 | + | 0.9998 | lnc-TMEM8B-1 | 0.656 | -4.334 | -4.055 | -4.558 | 24 | noncoding | -0.319071255 | VGDTEYR | n[145]VGDTEYR | LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ |
lnc-TMEM8B-1:2 | HCC | 7 | 0.447245 | noncoding | 43 | chr9 | 35858737 | 35865518 | + | 1 | lnc-TMEM8B-1 | 0.656 | -4.334 | -4.055 | -4.558 | 45 | noncoding | -0.319071255 | VGDTEYR | n[230]VGDTEYR | LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ |
lnc-TMEM8B-1:2 | HCC | 7 | 0.447245 | noncoding | 43 | chr9 | 35858737 | 35865518 | + | 1 | lnc-TMEM8B-1 | 0.656 | -4.334 | -4.055 | -4.558 | 45 | noncoding | -0.319071255 | VGDTEYR | LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ | |
lnc-TMEM8B-1:2 | LUAD | 7 | 0.447245 | noncoding | 43 | chr9 | 35858737 | 35865518 | + | 0.9999 | lnc-TMEM8B-1 | 0.656 | -4.334 | -4.055 | -4.558 | 17 | noncoding | -0.319071255 | VGDTEYR | n[230]VGDTEYR | LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ |
lnc-TMEM8B-1:2 | OV | 7 | 0.447245 | noncoding | 43 | chr9 | 35858737 | 35865518 | + | 0.9985 | lnc-TMEM8B-1 | 0.656 | -4.334 | -4.055 | -4.558 | 23 | noncoding | -0.319071255 | VGDTEYR | n[145]VGDTEYR | LLCKVGDTEYRRGTLLGQGFNQASVFTDFFIPVPSPPLPVLSQ |
Page 1 of 1
bottom of page