top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TMSB15A-3:1 | PRAD | 17 | 0.0200569 | noncoding | 50 | chrX | 102605080 | 102607319 | - | 0.9974 | lnc-TMSB15A-3 | 0.104 | -5.198 | -5.047 | -5.543 | 8 | noncoding | -0.457628258 | EISALSCLSQHYSQQPR | EISALSCLSQHYSQQPR | MIQQSYCWVCIKKKGYQYIKEISALSCLSQHYSQQPRYGINISTHKQMQG |
lnc-TMSB15A-6:1 | OV | 7 | 0.0349559 | noncoding | 58 | chrX | 102718424 | 102720663 | - | 0.8148 | lnc-TMSB15A-6 | 0.96 | -5.314 | -6.548 | -5.796 | 11 | noncoding | -0.344773272 | HVALSEK | n[145]HVALSEK | MLVSKTNIQTPICTTRIIPVKTYGLRWEAKLPLPYYLTKLGSGGEKKHVALSEKLYQT |
lnc-TMSB15A-6:1 | OV | 9 | 0.0349559 | noncoding | 58 | chrX | 102718424 | 102720663 | - | 0.087 | lnc-TMSB15A-6 | 0.96 | -5.314 | -6.548 | -5.796 | 1 | noncoding | -0.344773272 | TYGLRWEAK | n[145]TYGLRWEAK | MLVSKTNIQTPICTTRIIPVKTYGLRWEAKLPLPYYLTKLGSGGEKKHVALSEKLYQT |
lnc-TMSB15B-1:1 | CCRC | 8 | 0.0367397 | noncoding | 36 | chrX | 103918895 | 103932911 | + | 0.9965 | lnc-TMSB15B-1 | 0.981 | 0 | 0 | 0 | 31 | coding | 0.669260556 | SHMVYVIL | n[230]SHM[147]VYVIL | LQIQILLKKTVFYLYDNGTVIAEYYKMKSHMVYVIL |
lnc-TMSB15B-1:1 | CCRC | 8 | 0.0367397 | noncoding | 36 | chrX | 103918895 | 103932911 | + | 0.9965 | lnc-TMSB15B-1 | 0.981 | 0 | 0 | 0 | 31 | coding | 0.669260556 | SHMVYVIL | n[230]SHMVYVIL | LQIQILLKKTVFYLYDNGTVIAEYYKMKSHMVYVIL |
Page 1 of 1
bottom of page