top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TNN-3:1 | BRCA-Luminal A | 7 | 0.0952292 | noncoding | 44 | chr1 | 175556987 | 175563869 | + | 0.9969 | lnc-TNN-3 | 1 | -4.368 | -4.353 | 0.957 | 14 | noncoding | -0.375236202 | DLAGYVK | n[145]DLAGYVK | LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT |
lnc-TNN-3:1 | BRCA-Basal-like | 7 | 0.0952292 | noncoding | 44 | chr1 | 175556987 | 175563869 | + | 0.9969 | lnc-TNN-3 | 1 | -4.368 | -4.353 | 0.957 | 14 | noncoding | -0.375236202 | DLAGYVK | n[145]DLAGYVK | LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT |
lnc-TNN-3:1 | BRCA-Luminal B | 7 | 0.0952292 | noncoding | 44 | chr1 | 175556987 | 175563869 | + | 0.9969 | lnc-TNN-3 | 1 | -4.368 | -4.353 | 0.957 | 14 | noncoding | -0.375236202 | DLAGYVK | n[145]DLAGYVK | LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT |
lnc-TNN-3:1 | CCRC | 7 | 0.0952292 | noncoding | 44 | chr1 | 175556987 | 175563869 | + | 0.9998 | lnc-TNN-3 | 1 | -4.368 | -4.353 | 0.957 | 10 | noncoding | -0.375236202 | DLAGYVK | n[230]DLAGYVK | LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT |
lnc-TNN-3:1 | HCC | 7 | 0.0952292 | noncoding | 44 | chr1 | 175556987 | 175563869 | + | 0.9985 | lnc-TNN-3 | 1 | -4.368 | -4.353 | 0.957 | 6 | noncoding | -0.375236202 | DLAGYVK | n[230]DLAGYVK | LSDKGQRDLAGYVKLQVLAAVMSSPFCFFSARLQTPEVKHLMIT |
Page 1 of 1
bottom of page