top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TOMM20-7:1 | OV | 18 | 0.0893099 | noncoding | 73 | chr1 | 235006743 | 235011962 | - | 0.311 | lnc-TOMM20-7 | 0.037 | -2.976 | -5.038 | -5.389 | 2 | noncoding | -0.335594735 | LSHVGPPTFPPPMDLLSK | n[145]LSHVGPPTFPPPM[147]DLLSK | LSHVGPPTFPPPMDLLSKGSGAQALIAWEIRRDVWVGGLAWRVDILLQMALPSRKAIVIPRLPPGRVQPPEPS |
lnc-TOMM20-7:1 | OV | 12 | 0.0893099 | noncoding | 73 | chr1 | 235006743 | 235011962 | - | 0.6057 | lnc-TOMM20-7 | 0.037 | -2.976 | -5.038 | -5.389 | 6 | noncoding | -0.335594735 | VDILLQMALPSR | n[145]VDILLQM[147]ALPSR | LSHVGPPTFPPPMDLLSKGSGAQALIAWEIRRDVWVGGLAWRVDILLQMALPSRKAIVIPRLPPGRVQPPEPS |
lnc-TOMM20-7:1 | OV | 12 | 0.0893099 | noncoding | 73 | chr1 | 235006743 | 235011962 | - | 0.6057 | lnc-TOMM20-7 | 0.037 | -2.976 | -5.038 | -5.389 | 6 | noncoding | -0.335594735 | VDILLQMALPSR | n[145]VDILLQMALPSR | LSHVGPPTFPPPMDLLSKGSGAQALIAWEIRRDVWVGGLAWRVDILLQMALPSRKAIVIPRLPPGRVQPPEPS |
lnc-TOMM20L-1:1 | EOGC | 7 | 0.0000156 | noncoding | 40 | chr14 | 58398556 | 58427125 | + | 0.9979 | lnc-TOMM20L-1 | 0.707 | 0 | 0 | 0 | 5 | noncoding | -0.468460838 | LGVVGGR | n[145]LGVVGGR | LSQLYSNFFFFDTGSHSVAQALASDISTRLGVVGGRLSLG |
lnc-TOMM7-1:1 | OV | 13 | 0.0462717 | noncoding | 42 | chr7 | 22725394 | 22727620 | - | 0.8222 | lnc-TOMM7-1 | 0.792 | -5.3 | -5.854 | -5.91 | 4 | noncoding | -0.396018188 | MVSLAGGSLVSCK | n[145]M[147]VSLAGGSLVSCK | LNLLPRRHPRISYWVKLVQKPSSLRMVSLAGGSLVSCKWALD |
Page 1 of 1
bottom of page