top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TRDN-4:1 | HCC | 13 | 0.0202731 | noncoding | 66 | chr6 | 122859677 | 122859988 | - | 1 | lnc-TRDN-4 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.37624165 | FELVPPTPAEIPR | LATFWYYAKFELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLCGFMSERS | |
lnc-TREM1-2:1 | BRCA-Luminal A | 7 | 0.0413157 | noncoding | 67 | chr6 | 41308165 | 41308565 | - | 0.4866 | lnc-TREM1-2 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.30694692 | VTNPNAK | n[145]VTNPNAK | MLPSGFWNFLVHNVKELEVLLMRSKSYCAEIAHNVSSKDHKAIVERAAQLAIRVTNPNAKLCSEDNE |
lnc-TREM1-2:1 | CCRC | 15 | 0.0413157 | noncoding | 67 | chr6 | 41308165 | 41308565 | - | 0.3287 | lnc-TREM1-2 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.30694692 | MLPSGFWNFLVHNVK | n[230]MLPSGFWNFLVHNVK | MLPSGFWNFLVHNVKELEVLLMRSKSYCAEIAHNVSSKDHKAIVERAAQLAIRVTNPNAKLCSEDNE |
lnc-TREM1-2:1 | HCC | 7 | 0.0413157 | noncoding | 67 | chr6 | 41308165 | 41308565 | - | 0.9978 | lnc-TREM1-2 | 1 | 0 | 0 | 0 | 12 | noncoding | -0.30694692 | VTNPNAK | n[230]VTNPNAK | MLPSGFWNFLVHNVKELEVLLMRSKSYCAEIAHNVSSKDHKAIVERAAQLAIRVTNPNAKLCSEDNE |
lnc-TREM1-2:1 | LUAD | 7 | 0.0413157 | noncoding | 67 | chr6 | 41308165 | 41308565 | - | 0.9965 | lnc-TREM1-2 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.30694692 | VTNPNAK | n[230]VTNPNAK | MLPSGFWNFLVHNVKELEVLLMRSKSYCAEIAHNVSSKDHKAIVERAAQLAIRVTNPNAKLCSEDNE |
Page 1 of 1
bottom of page