top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TRIM26-2:3 | PRAD | 26 | 0.054731 | noncoding | 87 | chr6 | 30291005 | 30326851 | - | 0.8909 | lnc-TRIM26-2 | 1 | -1.125 | 1.626 | -0.437 | 1 | noncoding | -0.312687197 | RGCLVQAPGPGSGQAPPPPGAAESRR | RGCLVQAPGPGSGQAPPPPGAAESRR | LKPIARRALDWRPGRRGCLVQAPGPGSGQAPPPPGAAESRRRGRGGGGLWTSTLFLSSGQSGERVASCGGGQLRGGPAGLSWHVTSD |
lnc-TRIM26-2:46 | CCRC | 8 | 0.318622 | noncoding | 33 | chr6 | 30268547 | 30326642 | - | 0.994 | lnc-TRIM26-2 | 0.45 | 0 | 0 | 0 | 1 | noncoding | -0.322524411 | IISTMLNR | n[230]IISTMLNR | LPRIISTMLNRCGQSGHHCLVPDLTGKVCNFRH |
lnc-TRIM27-10:2 | CCRC | 8 | 0.0864582 | noncoding | 40 | chr6 | 28836254 | 28839023 | - | 0.6428 | lnc-TRIM27-10 | 0.17 | -4.346 | -4.782 | -4.215 | 1 | noncoding | -0.335538142 | FEISEITK | FEISEITK | LTSRKIPGPSIEGLRCRMRFAQLSAKRDAKPKFEISEITK |
lnc-TRIM27-10:2 | CCRC | 11 | 0.0864582 | noncoding | 40 | chr6 | 28836254 | 28839023 | - | 0.9951 | lnc-TRIM27-10 | 0.17 | -4.346 | -4.782 | -4.215 | 8 | noncoding | -0.335538142 | KIPGPSIEGLR | n[230]KIPGPSIEGLR | LTSRKIPGPSIEGLRCRMRFAQLSAKRDAKPKFEISEITK |
lnc-TRIM27-10:2 | OSCC | 11 | 0.0864582 | noncoding | 40 | chr6 | 28836254 | 28839023 | - | 0.9806 | lnc-TRIM27-10 | 0.17 | -4.346 | -4.782 | -4.215 | 10 | noncoding | -0.335538142 | KIPGPSIEGLR | n[145]KIPGPSIEGLR | LTSRKIPGPSIEGLRCRMRFAQLSAKRDAKPKFEISEITK |
Page 1 of 1
bottom of page