top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TRIM74-1:5 | BRCA-Luminal B | 11 | 0.18623 | noncoding | 44 | chr7 | 72946149 | 72948961 | - | 0.9972 | lnc-TRIM74-1 | 1 | -0.273 | 6.609 | 1.634 | 39 | noncoding | -0.302474176 | AAAGACTPPCT | n[145]AAAGACTPPCT | LNGSRCRPQPHRPKHQHQNAHPAQPQRERREQKAAAGACTPPCT |
lnc-TRIM74-1:5 | BRCA-Luminal A | 11 | 0.18623 | noncoding | 44 | chr7 | 72946149 | 72948961 | - | 0.9972 | lnc-TRIM74-1 | 1 | -0.273 | 6.609 | 1.634 | 39 | noncoding | -0.302474176 | AAAGACTPPCT | n[145]AAAGACTPPCT | LNGSRCRPQPHRPKHQHQNAHPAQPQRERREQKAAAGACTPPCT |
lnc-TRIM74-1:5 | BRCA-Basal-like | 11 | 0.18623 | noncoding | 44 | chr7 | 72946149 | 72948961 | - | 0.9972 | lnc-TRIM74-1 | 1 | -0.273 | 6.609 | 1.634 | 39 | noncoding | -0.302474176 | AAAGACTPPCT | n[145]AAAGACTPPCT | LNGSRCRPQPHRPKHQHQNAHPAQPQRERREQKAAAGACTPPCT |
lnc-TRIM74-1:6 | OV | 14 | 0.0347833 | noncoding | 62 | chr7 | 72946149 | 72948945 | - | 0.8062 | lnc-TRIM74-1 | 1 | 9.281 | 12.162 | -2.557 | 1 | noncoding | -0.276544459 | VQDALQQNPGAFSR | n[145]VQDALQQNPGAFSR | MVQDALQQNPGAFSRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT |
lnc-TRIM77-9:2 | OSCC | 9 | 0.0514855 | noncoding | 115 | chr11 | 89731016 | 89734782 | + | 0.963 | lnc-TRIM77-9 | 1 | 0 | 0 | 0 | 6 | noncoding | -0.298328318 | NHQQNIIEK | n[145]NHQQNIIEK | LAVCWVSWSLFLWLFIAMCLWKNHQQNIIEKYDPLGYLYQGSDINGQMVEHTTLSGANEINGNVHEGFLSQGGLSSGCSHLHHKVSNGVNATVNGSLNGGLYSGHTNSLTRTCEF |
Page 1 of 1
bottom of page