top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TSPAN17-1:1 | OV | 9 | 0.0379905 | noncoding | 62 | chr5 | 176675897 | 176678014 | + | 0.8461 | lnc-TSPAN17-1 | 0.175 | -5.685 | -5.286 | -4.906 | 3 | noncoding | -0.346442091 | ETLAVELPK | n[145]ETLAVELPK | LRDAGCTEKQRNKRRETLAVELPKSRSYHMQYIWNALCTACVSPSAWTDEVKHCLAVEDRRI |
lnc-TSPAN18-1:1 | OV | 9 | 0.0918603 | noncoding | 108 | chr11 | 44973901 | 44978025 | + | 0.8699 | lnc-TSPAN18-1 | 0.999 | 0 | 1.139 | 0 | 1 | noncoding | -0.341569413 | ETLWPSEAR | n[145]ETLWPSEAR | LEFSLHISFSSPPDHTHAHTHMHPHTPYTLRPEGFCRTPSWHSLQCCQRRTTLQGFANFPSKVKETLWPSEARSEATASERNLRHAGSAGRPRATYVISLNLISRKCL |
lnc-TSPAN18-1:1 | OV | 17 | 0.0918603 | noncoding | 98 | chr11 | 44973901 | 44978025 | + | 0.9656 | lnc-TSPAN18-1 | 0.998 | -3.506 | -2.967 | -2.116 | 21 | noncoding | -0.341569413 | GALQAAWHPSIPMAMLR | n[145]GALQAAWHPSIPM[147]AM[147]LR | MFGDKQPQQPGAGHIIHSQHQPWSPPTLLGEKGALQAAWHPSIPMAMLRSDLTVVISRWGHRTQARLGVGCLAIAGCHCHQGKGRSCEELLWKKQICS |
lnc-TSPAN18-1:1 | OV | 10 | 0.0918603 | noncoding | 65 | chr11 | 44973901 | 44978025 | + | 0.9707 | lnc-TSPAN18-1 | 0.998 | -4.931 | -2.967 | -2.116 | 4 | noncoding | -0.341569413 | MVPSHSPGGK | n[145]MVPSHSPGGK | MVPSHSPGGKRCFTGSVASEHPHGDAEVRPHCGDLTLGPPDSGQAGSRLSSHCWLSLSPREGEKL |
lnc-TSPAN18-1:1 | OV | 10 | 0.0918603 | noncoding | 65 | chr11 | 44973901 | 44978025 | + | 0.9707 | lnc-TSPAN18-1 | 0.998 | -4.931 | -2.967 | -2.116 | 4 | noncoding | -0.341569413 | MVPSHSPGGK | n[145]M[147]VPSHSPGGK | MVPSHSPGGKRCFTGSVASEHPHGDAEVRPHCGDLTLGPPDSGQAGSRLSSHCWLSLSPREGEKL |
Page 1 of 1
bottom of page