top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-TXLNB-3:16 | CCRC | 7 | 0.0258416 | noncoding | 39 | chr6 | 139197711 | 139239302 | - | 0.999 | lnc-TXLNB-3 | 0.924 | -4.874 | -3.633 | -4.878 | 5 | noncoding | -0.348304079 | QGAILEK | n[230]QGAILEK | MQGAILEKENGFSRHRTCWSLNLRLLSLQKYESINFCSL |
lnc-TXLNB-3:16 | OV | 7 | 0.0258416 | noncoding | 39 | chr6 | 139197711 | 139239302 | - | 0.7943 | lnc-TXLNB-3 | 0.924 | -4.874 | -3.633 | -4.878 | 1 | noncoding | -0.348304079 | QGAILEK | n[145]QGAILEK | MQGAILEKENGFSRHRTCWSLNLRLLSLQKYESINFCSL |
lnc-TXLNB-3:16 | OV | 15 | 0.0258416 | noncoding | 39 | chr6 | 139197711 | 139239302 | - | 0.3941 | lnc-TXLNB-3 | 0.924 | -4.874 | -3.633 | -4.878 | 2 | noncoding | -0.348304079 | QGAILEKENGFSRHR | n[145]QGAILEKENGFSRHR | MQGAILEKENGFSRHRTCWSLNLRLLSLQKYESINFCSL |
lnc-TXNDC12-2:1 | CCRC | 16 | 0.0274409 | noncoding | 44 | chr1 | 52160260 | 52160600 | - | 1 | lnc-TXNDC12-2 | 1 | 0 | 0 | 0 | 42 | noncoding | -0.336756128 | VDEFVTHNLSFEEINK | n[230]VDEFVTHNLSFEEINK | LVSEYMSKKIKVDEFVTHNLSFEEINKAFELMHSGKSIRTVVKI |
lnc-TXNDC12-2:1 | OV | 18 | 0.0274409 | noncoding | 44 | chr1 | 52160260 | 52160600 | - | 1 | lnc-TXNDC12-2 | 1 | 0 | 0 | 0 | 8 | noncoding | -0.336756128 | IKVDEFVTHNLSFEEINK | n[145]IKVDEFVTHNLSFEEINK | LVSEYMSKKIKVDEFVTHNLSFEEINKAFELMHSGKSIRTVVKI |
Page 1 of 1
bottom of page