top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-UMODL1-4:1 | CRC | 11 | 0.0720998 | noncoding | 65 | chr21 | 41767988 | 41776144 | + | 0.8775 | lnc-UMODL1-4 | 0.034 | -3.89 | -4.874 | -4.911 | 1 | noncoding | -0.337020034 | VGHLPVVCISR | VGHLPVVCISR | MRVGHLPVVCISRHSESMEKMSLEVFKPQHKQKAPGPVPLKTEERGVKPAPGATLKKCYSAGWEE |
lnc-UMODL1-7:1 | BRCA-Luminal B | 11 | 0.0201678 | noncoding | 39 | chr21 | 41885094 | 41885851 | + | 0.9948 | lnc-UMODL1-7 | 1 | -3.548 | -0.098 | -4.074 | 8 | noncoding | -0.420751653 | LFVFQPHLLQR | n[145]LFVFQPHLLQR | LFVFQPHLLQRNPPKPVCRLAAGLSSAFKVLLRNTIIVT |
lnc-UMODL1-7:1 | BRCA-Basal-like | 11 | 0.0201678 | noncoding | 39 | chr21 | 41885094 | 41885851 | + | 0.9948 | lnc-UMODL1-7 | 1 | -3.548 | -0.098 | -4.074 | 8 | noncoding | -0.420751653 | LFVFQPHLLQR | n[145]LFVFQPHLLQR | LFVFQPHLLQRNPPKPVCRLAAGLSSAFKVLLRNTIIVT |
lnc-UMODL1-7:1 | BRCA-Luminal A | 11 | 0.0201678 | noncoding | 39 | chr21 | 41885094 | 41885851 | + | 0.9948 | lnc-UMODL1-7 | 1 | -3.548 | -0.098 | -4.074 | 8 | noncoding | -0.420751653 | LFVFQPHLLQR | n[145]LFVFQPHLLQR | LFVFQPHLLQRNPPKPVCRLAAGLSSAFKVLLRNTIIVT |
lnc-UMODL1-7:1 | BRCA-HER2-enriched | 11 | 0.0201678 | noncoding | 39 | chr21 | 41885094 | 41885851 | + | 0.9948 | lnc-UMODL1-7 | 1 | -3.548 | -0.098 | -4.074 | 8 | noncoding | -0.420751653 | LFVFQPHLLQR | n[145]LFVFQPHLLQR | LFVFQPHLLQRNPPKPVCRLAAGLSSAFKVLLRNTIIVT |
Page 1 of 1
bottom of page