top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-UGT2B7-1:1 | BRCA-Luminal B | 9 | 0.0443169 | noncoding | 53 | chr4 | 69125273 | 69126451 | + | 0.9965 | lnc-UGT2B7-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.406420066 | AKEHINLCK | n[145]AKEHINLCK | MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR |
lnc-UGT2B7-1:1 | BRCA-Luminal A | 9 | 0.0443169 | noncoding | 53 | chr4 | 69125273 | 69126451 | + | 0.9965 | lnc-UGT2B7-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.406420066 | AKEHINLCK | n[145]AKEHINLCK | MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR |
lnc-UGT2B7-1:1 | BRCA-Basal-like | 9 | 0.0443169 | noncoding | 53 | chr4 | 69125273 | 69126451 | + | 0.9965 | lnc-UGT2B7-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.406420066 | AKEHINLCK | n[145]AKEHINLCK | MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR |
lnc-UGT2B7-1:1 | BRCA-Luminal A | 7 | 0.0443169 | noncoding | 53 | chr4 | 69125273 | 69126451 | + | 0.7094 | lnc-UGT2B7-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.406420066 | EHINLCK | n[145]EHINLCK | MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR |
lnc-UGT2B7-1:1 | BRCA-Luminal B | 7 | 0.0443169 | noncoding | 53 | chr4 | 69125273 | 69126451 | + | 0.7094 | lnc-UGT2B7-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.406420066 | EHINLCK | n[145]EHINLCK | MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR |
Page 1 of 1
bottom of page