top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-UQCRFS1-3:24 | OV | 13 | 0.297842 | noncoding | 51 | chr19 | 28410851 | 28535256 | - | 0.9968 | lnc-UQCRFS1-3 | 0.025 | -3.859 | 0 | -4.083 | 50 | noncoding | -0.320632764 | LFSVFPTLPPHWR | n[145]LFSVFPTLPPHWR | LDWRWGLARLFSVFPTLPPHWRREALLDCLPHWPHSLLPFWSITVVVGGGG |
lnc-UQCRFS1-3:24 | OV | 16 | 0.297842 | noncoding | 35 | chr19 | 28410851 | 28535256 | - | 0.9983 | lnc-UQCRFS1-3 | 0.997 | -5.55 | -5.666 | -4.242 | 111 | noncoding | -0.320632764 | LNVIFLMATSVLISPK | n[145]LNVIFLM[147]ATSVLISPK | LNVIFLMATSVLISPKLFWNGACSYWGLCIIFMSM |
lnc-UQCRHL-5:1 | OV | 18 | 0.0629893 | noncoding | 65 | chr1 | 15847052 | 15847512 | - | 0.95 | lnc-UQCRHL-5 | 0.277 | 0 | -2.405 | -1.266 | 2 | noncoding | -0.342022954 | SLAPPAATPGPGLVEDMK | n[145]SLAPPAATPGPGLVEDMK | LRKQERSLAPPAATPGPGLVEDMKRNAIGFHRATGQSGCQGLSPRSQDPFVLRSPGGQLLAFPDT |
lnc-UQCRHL-5:1 | OV | 19 | 0.0629893 | noncoding | 65 | chr1 | 15847052 | 15847512 | - | 0.1247 | lnc-UQCRHL-5 | 0.277 | 0 | -2.405 | -1.266 | 1 | noncoding | -0.342022954 | SLAPPAATPGPGLVEDMKR | n[145]SLAPPAATPGPGLVEDMKR | LRKQERSLAPPAATPGPGLVEDMKRNAIGFHRATGQSGCQGLSPRSQDPFVLRSPGGQLLAFPDT |
lnc-URGCP-2:11 | BRCA-Luminal B | 13 | 0.794276 | coding | 42 | chr7 | 43940055 | 43990265 | - | 0.9978 | lnc-URGCP-2 | 0.149 | 0 | 0 | 0 | 1 | coding | 0.765268727 | HGSVNLQSQLLWR | n[145]HGSVNLQSQLLWR | LSQNKTKEKLARHGSVNLQSQLLWRLRWEDRLSPGVGGCSEL |
Page 1 of 1
bottom of page