top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-UPRT-5:1 | EOGC | 19 | 0.0380692 | noncoding | 49 | chrX | 75736171 | 75737055 | + | 0.9974 | lnc-UPRT-5 | 0.585 | 0 | 0 | 0 | 2 | noncoding | -0.427635606 | TQDGGGAGCLPQSQVFQCR | n[145]TQDGGGAGCLPQSQVFQCR | LWVKAGTVLLPRTQDGGGAGCLPQSQVFQCRTHKSGEIFLHHWCRADCG |
lnc-UPRT-6:1 | OSCC | 8 | 0.0117349 | noncoding | 84 | chrX | 75523174 | 75523652 | + | 0.9343 | lnc-UPRT-6 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.369047429 | LDAGLDLR | n[145]LDAGLDLR | LPPPHPVSRLDAGLDLRKIVKPKKFGSAHLLLLHCVRPLCFCLSLSVSLRSLSLPLLPPPTVTHTHTHTHTHTHTHTQCERCEP |
lnc-UQCC2-1:1 | CCRC | 9 | 0.99969 | coding | 33 | chr6 | 33679115 | 33684690 | - | 0.9963 | lnc-UQCC2-1 | 1 | 1.314 | -3.032 | -0.872 | 20 | noncoding | -0.286824948 | GGSAGVLVR | n[230]GGSAGVLVR | LGGKGGSAGVLVRGQFSQPEARLRAATPGDRVN |
lnc-UQCC2-1:1 | EOGC | 9 | 0.99969 | coding | 33 | chr6 | 33679115 | 33684690 | - | 0.9991 | lnc-UQCC2-1 | 1 | 1.314 | -3.032 | -0.872 | 6 | noncoding | -0.286824948 | GGSAGVLVR | n[145]GGSAGVLVR | LGGKGGSAGVLVRGQFSQPEARLRAATPGDRVN |
lnc-UQCRFS1-3:13 | OV | 11 | 0.126667 | noncoding | 113 | chr19 | 28629229 | 28727671 | - | 0.2206 | lnc-UQCRFS1-3 | 0.617 | 0 | 0 | 0 | 1 | noncoding | -0.309777556 | ASLHSTPSQLR | n[145]ASLHSTPSQLR | LCCLSWGCAKSLASLLGMAAGTRLTVGFQVGLSGASAKFLGGSVFSWRPKEDYGGSPVARIVKVCDGEVGPGASHLIHPFLGVRASLHSTPSQLRRLPGSTVPCFPWVPLVLW |
Page 1 of 1
bottom of page