top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-USP25-6:1 | EOGC | 9 | 0.0479821 | noncoding | 38 | chr21 | 15434401 | 15437227 | + | 0.9523 | lnc-USP25-6 | 0.024 | 0 | 0 | 0 | 1 | noncoding | -0.472114172 | ELLPVLGGR | n[145]ELLPVLGGR | LVSEGNRGSKAIVFFGRTSLSQIRKLQRELLPVLGGRN |
lnc-USP25-6:1 | EOGC | 10 | 0.0479821 | noncoding | 38 | chr21 | 15434401 | 15437227 | + | 0.6127 | lnc-USP25-6 | 0.024 | 0 | 0 | 0 | 22 | noncoding | -0.472114172 | ELLPVLGGRN | n[145]ELLPVLGGRN | LVSEGNRGSKAIVFFGRTSLSQIRKLQRELLPVLGGRN |
lnc-USP25-6:1 | EOGC | 10 | 0.0479821 | noncoding | 38 | chr21 | 15434401 | 15437227 | + | 0.0523 | lnc-USP25-6 | 0.024 | 0 | 0 | 0 | 2 | noncoding | -0.472114172 | LVSEGNRGSK | n[145]LVSEGNRGSK | LVSEGNRGSKAIVFFGRTSLSQIRKLQRELLPVLGGRN |
lnc-USP25-6:1 | LUAD | 10 | 0.0479821 | noncoding | 38 | chr21 | 15434401 | 15437227 | + | 0.7538 | lnc-USP25-6 | 0.024 | 0 | 0 | 0 | 16 | noncoding | -0.472114172 | ELLPVLGGRN | n[230]ELLPVLGGRN | LVSEGNRGSKAIVFFGRTSLSQIRKLQRELLPVLGGRN |
lnc-USP29-2:1 | PRAD | 10 | 0.148582 | noncoding | 75 | chr19 | 57065333 | 57066139 | + | 0.3939 | lnc-USP29-2 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.304962338 | KVAPVPAVMK | KVAPVPAVM[147]K | MQKKKKKNAKEKKVAPVPAVMKKQETMKLVNPLFEKRPKIRILALDRTSNPKRTSRALSNSLTLQWQRTILSVSG |
Page 1 of 1
bottom of page