top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VASH1-1:1 | OV | 12 | 0.373056 | noncoding | 41 | chr14 | 76633713 | 76634028 | + | 0.638 | lnc-VASH1-1 | 1 | 0 | 0 | 0 | 4 | noncoding | -0.339138119 | TERADLIAYLKK | n[145]TERADLIAYLKK | LMEYLETPKKYIPGTKVIFAGIKKKTERADLIAYLKKATIE |
lnc-VASH1-1:1 | PRAD | 7 | 0.373056 | noncoding | 41 | chr14 | 76633713 | 76634028 | + | 0.9261 | lnc-VASH1-1 | 1 | 0 | 0 | 0 | 7 | noncoding | -0.339138119 | VIFAGIK | LMEYLETPKKYIPGTKVIFAGIKKKTERADLIAYLKKATIE | |
lnc-VASH2-3:1 | OV | 24 | 0.0303362 | noncoding | 58 | chr1 | 213015914 | 213018244 | + | 0.9044 | lnc-VASH2-3 | 0.142 | 0 | 0 | 0 | 6 | noncoding | -0.351016493 | MYVYGPGAVAHACNPSTLGGQGGR | n[145]MYVYGPGAVAHACNPSTLGGQGGR | MELRYHRILQLMLRKHSHSSHFKMYVYGPGAVAHACNPSTLGGQGGRITRSGDRDHPG |
lnc-VAV3-11:1 | OV | 12 | 0.0518038 | noncoding | 62 | chr1 | 107046539 | 107056615 | - | 0.986 | lnc-VAV3-11 | 0.3 | 0 | 0 | 0 | 4 | noncoding | -0.349949833 | MVYSHQSLINLK | n[145]MVYSHQSLINLK | MVYSHQSLINLKYLPRNLCLRRICVWLMACRDGGRTIWSGGREPKDFLELNQTEKPQLSKPK |
lnc-VAV3-11:1 | OV | 12 | 0.0518038 | noncoding | 62 | chr1 | 107046539 | 107056615 | - | 0.986 | lnc-VAV3-11 | 0.3 | 0 | 0 | 0 | 4 | noncoding | -0.349949833 | MVYSHQSLINLK | n[145]M[147]VYSHQSLINLK | MVYSHQSLINLKYLPRNLCLRRICVWLMACRDGGRTIWSGGREPKDFLELNQTEKPQLSKPK |
Page 1 of 1
bottom of page