top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VIRMA-1:1 | OV | 9 | 0.117505 | noncoding | 39 | chr8 | 94637357 | 94640841 | - | 0.4589 | lnc-VIRMA-1 | 1 | 0.272 | 1.117 | 0 | 2 | noncoding | -0.287720707 | LDEWRGEGR | n[145]LDEWRGEGR | LDEWRGEGRGGGGGDVRGREEAVDTQRVDEARRGKGSER |
lnc-VIRMA-1:2 | CCRC | 8 | 0.448675 | noncoding | 39 | chr8 | 94626966 | 94640745 | - | 0.9997 | lnc-VIRMA-1 | 0.917 | -4.473 | -5.802 | 0 | 12 | coding | 0.660818579 | MAFLDYNK | n[272]M[147]AFLDYNK | MAFLDYNKTKILMCFNAMSLKISICMCVYVWHIYMYIYI |
lnc-VIRMA-1:2 | CCRC | 21 | 0.448675 | noncoding | 39 | chr8 | 94626966 | 94640745 | - | 0.1227 | lnc-VIRMA-1 | 0.917 | -4.473 | -5.802 | 0 | 1 | coding | 0.660818579 | MAFLDYNKTKILMCFNAMSLK | n[272]M[147]AFLDYNKTKILMCFNAM[147]SLK | MAFLDYNKTKILMCFNAMSLKISICMCVYVWHIYMYIYI |
lnc-VIRMA-1:2 | LUAD | 8 | 0.448675 | noncoding | 39 | chr8 | 94626966 | 94640745 | - | 0.9989 | lnc-VIRMA-1 | 0.917 | -4.473 | -5.802 | 0 | 16 | coding | 0.660818579 | MAFLDYNK | n[272]M[147]AFLDYNK | MAFLDYNKTKILMCFNAMSLKISICMCVYVWHIYMYIYI |
lnc-VIRMA-1:2 | OV | 17 | 0.448675 | noncoding | 40 | chr8 | 94626966 | 94640745 | - | 0.9605 | lnc-VIRMA-1 | 0.088 | 0 | 0 | 0 | 8 | coding | 0.660818579 | LEVAVSQDCATTLQPRR | n[145]LEVAVSQDCATTLQPRR | LEVAVSQDCATTLQPRRKRETPSKRKKKKRKRKETLMSFL |
Page 1 of 1
bottom of page