top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VGLL3-10:1 | BRCA-Luminal A | 10 | 0.116398 | noncoding | 65 | chr3 | 84691680 | 84692591 | - | 0.9974 | lnc-VGLL3-10 | 1 | 0 | 0 | 0 | 38 | noncoding | -0.411625712 | LTFLVQNGPR | n[145]LTFLVQNGPR | MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS |
lnc-VGLL3-10:1 | BRCA-HER2-enriched | 10 | 0.116398 | noncoding | 65 | chr3 | 84691680 | 84692591 | - | 0.9974 | lnc-VGLL3-10 | 1 | 0 | 0 | 0 | 38 | noncoding | -0.411625712 | LTFLVQNGPR | n[145]LTFLVQNGPR | MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS |
lnc-VGLL3-10:1 | CCRC | 10 | 0.116398 | noncoding | 65 | chr3 | 84691680 | 84692591 | - | 0.9971 | lnc-VGLL3-10 | 1 | 0 | 0 | 0 | 25 | noncoding | -0.411625712 | LTFLVQNGPR | n[230]LTFLVQNGPR | MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS |
lnc-VGLL3-10:1 | EOGC | 10 | 0.116398 | noncoding | 65 | chr3 | 84691680 | 84692591 | - | 0.9992 | lnc-VGLL3-10 | 1 | 0 | 0 | 0 | 117 | noncoding | -0.411625712 | LTFLVQNGPR | n[145]LTFLVQNGPR | MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS |
lnc-VGLL3-10:1 | HCC | 10 | 0.116398 | noncoding | 65 | chr3 | 84691680 | 84692591 | - | 0.9973 | lnc-VGLL3-10 | 1 | 0 | 0 | 0 | 16 | noncoding | -0.411625712 | LTFLVQNGPR | n[230]LTFLVQNGPR | MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS |
Page 1 of 1
bottom of page