top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VSTM2B-14:1 | OV | 15 | 0.927931 | coding | 45 | chr19 | 28606687 | 28615229 | + | 0.9203 | lnc-VSTM2B-14 | 0.257 | 0 | 0 | 0 | 4 | noncoding | -0.267613013 | VLGSHGNYILPTDHK | n[145]VLGSHGNYILPTDHK | LPLQIGSDNRLAFVADLVQKRAKVLGSHGNYILPTDHKVLETWSG |
lnc-VSTM2B-17:1 | OSCC | 9 | 0.00806332 | noncoding | 39 | chr19 | 28065266 | 28125430 | + | 0.949 | lnc-VSTM2B-17 | 0.158 | -5.483 | -6.087 | -5.421 | 4 | noncoding | -0.4522342 | NLEMESDRK | n[145]NLEMESDRK | LEHFNSHLIHLRKDTSSPHFASNFTDKRSKNLEMESDRK |
lnc-VSTM2B-5:10 | OV | 16 | 0.0536786 | noncoding | 61 | chr19 | 29213234 | 29215826 | + | 0.9911 | lnc-VSTM2B-5 | 0.009 | 0 | 0 | 0 | 3 | noncoding | -0.345096706 | SPVSPSQSTGIIGMSK | n[145]SPVSPSQSTGIIGM[147]SK | MRSHYIAHSSLELLASRSPVSPSQSTGIIGMSKFTWPQFDPNISLIPLYTYLPLLTEKILS |
lnc-VSTM2B-5:10 | OV | 16 | 0.0536786 | noncoding | 61 | chr19 | 29213234 | 29215826 | + | 0.9911 | lnc-VSTM2B-5 | 0.009 | 0 | 0 | 0 | 3 | noncoding | -0.345096706 | SPVSPSQSTGIIGMSK | n[145]SPVSPSQSTGIIGMSK | MRSHYIAHSSLELLASRSPVSPSQSTGIIGMSKFTWPQFDPNISLIPLYTYLPLLTEKILS |
lnc-VSTM2B-7:9 | OV | 18 | 0.328962 | noncoding | 51 | chr19 | 28883575 | 28898042 | + | 0.6043 | lnc-VSTM2B-7 | 0.068 | 0 | 0 | 0 | 2 | noncoding | -0.323225731 | IKMPTGLVSGEGPLSTSK | n[145]IKMPTGLVSGEGPLSTSK | LCCNNRIPETRWFINNGNIFLTVLEAGKSKIKMPTGLVSGEGPLSTSKTMP |
Page 1 of 1
bottom of page