top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-VPS72-1:1 | OV | 18 | 0.0634429 | noncoding | 64 | chr1 | 151196663 | 151215834 | - | 0.52 | lnc-VPS72-1 | 0.8 | 0 | 0 | 0 | 4 | noncoding | -0.34112761 | LGQENGMNLGGGACSERR | n[145]LGQENGMNLGGGACSERR | LGQENGMNLGGGACSERRSRHCTLAWTTERNCLKTKQNKQTKKTGFVTPRMTWLSSFQMSCGSS |
lnc-VPS72-1:1 | OV | 20 | 0.0634429 | noncoding | 64 | chr1 | 151196663 | 151215834 | - | 0.5932 | lnc-VPS72-1 | 0.8 | 0 | 0 | 0 | 1 | noncoding | -0.34112761 | LGQENGMNLGGGACSERRSR | n[145]LGQENGMNLGGGACSERRSR | LGQENGMNLGGGACSERRSRHCTLAWTTERNCLKTKQNKQTKKTGFVTPRMTWLSSFQMSCGSS |
lnc-VPS8-3:1 | EOGC | 11 | 0.012408 | noncoding | 36 | chr3 | 184741936 | 184742462 | + | 0.2643 | lnc-VPS8-3 | 0.03 | -5.775 | -5.958 | -4.132 | 2 | noncoding | -0.41200204 | CLCTFISPSVK | n[145]CLCTFISPSVK | MTECAPKCLCTFISPSVKCGKKSCKTMCFQLPEIKS |
lnc-VPS8-3:1 | EOGC | 10 | 0.012408 | noncoding | 36 | chr3 | 184741936 | 184742462 | + | 0.9994 | lnc-VPS8-3 | 0.03 | -5.775 | -5.958 | -4.132 | 9 | noncoding | -0.41200204 | TMCFQLPEIK | n[145]TMCFQLPEIK | MTECAPKCLCTFISPSVKCGKKSCKTMCFQLPEIKS |
lnc-VRK2-10:1 | OV | 19 | 0.0472239 | noncoding | 52 | chr2 | 57755427 | 57765210 | + | 0.3636 | lnc-VRK2-10 | 0.629 | -4.267 | -2.109 | -5.005 | 1 | noncoding | -0.367203063 | MLMLLFQELLFENLLVGYK | n[145]MLMLLFQELLFENLLVGYK | MLMLLFQELLFENLLVGYKTSFFNEESEKLRGKQRDSLKMRQDMKSLHRGRG |
Page 1 of 1
bottom of page