top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WDR4-1:1 | BRCA-Luminal A | 8 | 0.123829 | noncoding | 52 | chr21 | 42835528 | 42837695 | - | 0.9964 | lnc-WDR4-1 | 0.467 | 0 | 0 | 0 | 13 | noncoding | -0.290976343 | ILMDTVSK | n[145]ILMDTVSK | LENRILMDTVSKFKDKKNWTEYWRSSLSNSRLLGCAAQDSFECGPTQICKLS |
lnc-WDR4-1:1 | BRCA-Basal-like | 8 | 0.123829 | noncoding | 52 | chr21 | 42835528 | 42837695 | - | 0.9964 | lnc-WDR4-1 | 0.467 | 0 | 0 | 0 | 13 | noncoding | -0.290976343 | ILMDTVSK | n[145]ILMDTVSK | LENRILMDTVSKFKDKKNWTEYWRSSLSNSRLLGCAAQDSFECGPTQICKLS |
lnc-WDR4-1:1 | OV | 8 | 0.123829 | noncoding | 52 | chr21 | 42835528 | 42837695 | - | 0.9169 | lnc-WDR4-1 | 0.467 | 0 | 0 | 0 | 1 | noncoding | -0.290976343 | ILMDTVSK | n[145]ILMDTVSK | LENRILMDTVSKFKDKKNWTEYWRSSLSNSRLLGCAAQDSFECGPTQICKLS |
lnc-WDR4-1:1 | OV | 19 | 0.123829 | noncoding | 52 | chr21 | 42835528 | 42837695 | - | 0.2296 | lnc-WDR4-1 | 0.467 | 0 | 0 | 0 | 1 | noncoding | -0.290976343 | LLGCAAQDSFECGPTQICK | n[145]LLGCAAQDSFECGPTQICK | LENRILMDTVSKFKDKKNWTEYWRSSLSNSRLLGCAAQDSFECGPTQICKLS |
lnc-WDR4-1:3 | OV | 8 | 0.904345 | coding | 33 | chr21 | 42827613 | 42838647 | - | 0.9714 | lnc-WDR4-1 | 0.269 | 0 | 0 | 0 | 11 | noncoding | -0.290976343 | ELEVIMLK | n[145]ELEVIMLK | MELEVIMLKKINQAQNTNITCAHLFVGSKNQNN |
Page 1 of 1
bottom of page