top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WBP4-2:9 | OV | 11 | 0.0997142 | noncoding | 48 | chr13 | 41132958 | 41183955 | + | 0.5659 | lnc-WBP4-2 | 1 | -5.199 | -4.848 | -4.483 | 5 | noncoding | -0.356063803 | MIMANEVGFNR | n[145]M[147]IMANEVGFNR | MIMANEVGFNRRADKYITPYTTAKMIQAQKMLCSLTFVRYPFLKHSYM |
lnc-WBP4-2:9 | OV | 11 | 0.0997142 | noncoding | 48 | chr13 | 41132958 | 41183955 | + | 0.5659 | lnc-WBP4-2 | 1 | -5.199 | -4.848 | -4.483 | 5 | noncoding | -0.356063803 | MIMANEVGFNR | n[145]MIM[147]ANEVGFNR | MIMANEVGFNRRADKYITPYTTAKMIQAQKMLCSLTFVRYPFLKHSYM |
lnc-WDPCP-1:16 | OV | 10 | 0.567417 | coding | 43 | chr2 | 63043418 | 63046566 | - | 0.9265 | lnc-WDPCP-1 | 1 | -3.061 | -4.2 | -3.957 | 1 | coding | 0.650661055 | GNSILYLQIK | n[145]GNSILYLQIK | MCWFKSPPTPSKAKFIQDSKLLSSFMKANGARGNSILYLQIKN |
lnc-WDR1-1:2 | HCC | 7 | 0.134955 | noncoding | 44 | chr4 | 10068090 | 10073019 | - | 0.997 | lnc-WDR1-1 | 0.036 | -4.244 | -3.147 | -4.67 | 2 | noncoding | -0.301812092 | NLNSVFR | n[230]NLNSVFR | LEIHKENGLPQIHSWKRNKNLNSVFRELDFYPWHYTKIQQVKIS |
lnc-WDR11-1:3 | BRCA-Basal-like | 9 | 0.455434 | noncoding | 131 | chr10 | 120818232 | 120825291 | + | 0.8462 | lnc-WDR11-1 | 0.213 | -3.516 | -4.535 | -4.945 | 10 | noncoding | -0.348996878 | IYCAILNLK | n[145]IYCAILNLK | LEPVNMLPYMAKGTYFADMIKRDSEGVRVKEDNMTTSQEGFEDATLLALKGARARESKECSSSSWKGHSSPLEPLEGAQPCQHRRFSPDAPFQTSDLQNYKRIYCAILNLKVCGHLFQQQQETNLSTKHCI |
Page 1 of 1
bottom of page