top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WDR4-2:5 | OSCC | 8 | 0.5 | coding | 59 | chr21 | 42909599 | 42955810 | - | 0.9951 | lnc-WDR4-2 | 0.405 | 0 | 0 | 0 | 5 | coding | 0.645362444 | YASISVSR | n[145]YASISVSR | MRYASISVSRGVTLNRMGGRFPLSSVQLDFSLVILGPKIFFFHMGNMGGSLKLRSQRLQ |
lnc-WDR4-2:6 | BRCA-HER2-enriched | 8 | 0.373307 | noncoding | 70 | chr21 | 42944424 | 42955810 | - | 0.9972 | lnc-WDR4-2 | 0 | 0 | 0 | 0 | 26 | noncoding | -0.317773382 | GAGGIYIK | n[145]GAGGIYIK | MAQMHSICSGNCFANKKKKKRGKRITFRGNLIVSTSHQFRSILREKKKKRKKKGAGGIYIKRVLYGKFLS |
lnc-WDR4-2:6 | BRCA-Luminal B | 8 | 0.373307 | noncoding | 70 | chr21 | 42944424 | 42955810 | - | 0.9972 | lnc-WDR4-2 | 0 | 0 | 0 | 0 | 26 | noncoding | -0.317773382 | GAGGIYIK | n[145]GAGGIYIK | MAQMHSICSGNCFANKKKKKRGKRITFRGNLIVSTSHQFRSILREKKKKRKKKGAGGIYIKRVLYGKFLS |
lnc-WDR4-2:6 | BRCA-Luminal A | 8 | 0.373307 | noncoding | 70 | chr21 | 42944424 | 42955810 | - | 0.9972 | lnc-WDR4-2 | 0 | 0 | 0 | 0 | 26 | noncoding | -0.317773382 | GAGGIYIK | n[145]GAGGIYIK | MAQMHSICSGNCFANKKKKKRGKRITFRGNLIVSTSHQFRSILREKKKKRKKKGAGGIYIKRVLYGKFLS |
lnc-WDR4-2:6 | BRCA-Basal-like | 8 | 0.373307 | noncoding | 70 | chr21 | 42944424 | 42955810 | - | 0.9972 | lnc-WDR4-2 | 0 | 0 | 0 | 0 | 26 | noncoding | -0.317773382 | GAGGIYIK | n[145]GAGGIYIK | MAQMHSICSGNCFANKKKKKRGKRITFRGNLIVSTSHQFRSILREKKKKRKKKGAGGIYIKRVLYGKFLS |
Page 1 of 1
bottom of page