top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WDR73-4:2 | CCRC | 8 | 1 | coding | 61 | chr15 | 84398315 | 84411701 | - | 0.999 | lnc-WDR73-4 | 1 | -2.63 | -3.292 | 3.113 | 23 | coding | 0.825533024 | LQPHGPSR | n[230]LQPHGPSR | LDPAAGVRQAAPGHHGAGGAGLGALPLCGQRLQPHGPSRRPGYHQHGRAPPWHQPRHPQRG |
lnc-WDR73-4:2 | LUAD | 8 | 1 | coding | 61 | chr15 | 84398315 | 84411701 | - | 0.9982 | lnc-WDR73-4 | 1 | -2.63 | -3.292 | 3.113 | 20 | coding | 0.825533024 | LQPHGPSR | n[230]LQPHGPSR | LDPAAGVRQAAPGHHGAGGAGLGALPLCGQRLQPHGPSRRPGYHQHGRAPPWHQPRHPQRG |
lnc-WDR73-4:2 | OV | 8 | 1 | coding | 61 | chr15 | 84398315 | 84411701 | - | 0.9882 | lnc-WDR73-4 | 1 | -2.63 | -3.292 | 3.113 | 13 | coding | 0.825533024 | LQPHGPSR | n[145]LQPHGPSR | LDPAAGVRQAAPGHHGAGGAGLGALPLCGQRLQPHGPSRRPGYHQHGRAPPWHQPRHPQRG |
lnc-WDR73-4:2 | OV | 23 | 1 | coding | 61 | chr15 | 84398315 | 84411701 | - | 0.6396 | lnc-WDR73-4 | 1 | -2.63 | -3.292 | 3.113 | 1 | coding | 0.825533024 | QAAPGHHGAGGAGLGALPLCGQR | n[145]QAAPGHHGAGGAGLGALPLCGQR | LDPAAGVRQAAPGHHGAGGAGLGALPLCGQRLQPHGPSRRPGYHQHGRAPPWHQPRHPQRG |
lnc-WDR87-1:3 | PRAD | 10 | 0.0794524 | noncoding | 82 | chr19 | 37793432 | 37817261 | - | 0.6658 | lnc-WDR87-1 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.423227676 | ISMVLPSGTR | LEAHPRLQWQFVLSLPVRQSNTICYRKNRISMVLPSGTRETALRAKGHRGLPENPVQLSEALNCRDKLCNWIPVGQCPAARS |
Page 1 of 1
bottom of page