top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WDR73-3:10 | PRAD | 15 | 1 | coding | 39 | chr15 | 84504506 | 84516847 | - | 1 | lnc-WDR73-3 | 1 | -3.543 | -3.932 | -2.686 | 12 | coding | 0.844346691 | GGMCLEVEVGPGALR | GGMCLEVEVGPGALR | LRRGGMCLEVEVGPGALRTGWTCLTRSAGSWRESREKTG |
lnc-WDR73-3:2 | OV | 22 | 0.0536767 | noncoding | 53 | chr15 | 84563413 | 84571216 | - | 0.4988 | lnc-WDR73-3 | 1 | -3.747 | -0.465 | 0.495 | 1 | noncoding | -0.283971165 | GPAVLGQSQEGAAGSAHMLWTR | n[145]GPAVLGQSQEGAAGSAHMLWTR | MGPAVLGQSQEGAAGSAHMLWTRAPAETGAHRARGGERTRSRRGSSGSTATSR |
lnc-WDR73-3:2 | OV | 33 | 0.0536767 | noncoding | 53 | chr15 | 84563413 | 84571216 | - | 0.2955 | lnc-WDR73-3 | 1 | -3.747 | -0.465 | 0.495 | 14 | noncoding | -0.283971165 | GPAVLGQSQEGAAGSAHMLWTRAPAETGAHRAR | n[145]GPAVLGQSQEGAAGSAHM[147]LWTRAPAETGAHRAR | MGPAVLGQSQEGAAGSAHMLWTRAPAETGAHRARGGERTRSRRGSSGSTATSR |
lnc-WDR73-3:2 | OV | 23 | 0.0536767 | noncoding | 53 | chr15 | 84563413 | 84571216 | - | 0.4218 | lnc-WDR73-3 | 1 | -3.747 | -0.465 | 0.495 | 3 | noncoding | -0.283971165 | MGPAVLGQSQEGAAGSAHMLWTR | n[145]M[147]GPAVLGQSQEGAAGSAHM[147]LWTR | MGPAVLGQSQEGAAGSAHMLWTRAPAETGAHRARGGERTRSRRGSSGSTATSR |
lnc-WDR73-3:2 | OV | 23 | 0.0536767 | noncoding | 53 | chr15 | 84563413 | 84571216 | - | 0.4218 | lnc-WDR73-3 | 1 | -3.747 | -0.465 | 0.495 | 3 | noncoding | -0.283971165 | MGPAVLGQSQEGAAGSAHMLWTR | n[145]M[147]GPAVLGQSQEGAAGSAHMLWTR | MGPAVLGQSQEGAAGSAHMLWTRAPAETGAHRARGGERTRSRRGSSGSTATSR |
Page 1 of 1
bottom of page