top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WNT16-1:1 | EOGC | 18 | 0.199584 | noncoding | 46 | chr7 | 121398451 | 121398767 | + | 0.8967 | lnc-WNT16-1 | 1 | 0 | 0 | 0 | 6 | noncoding | -0.370643748 | GYTDGVFGESQEAHLWNK | n[145]GYTDGVFGESQEAHLWNK | LGRGYTDGVFGESQEAHLWNKVIFASIKKKAERADLIAYLKKATNE |
lnc-WNT3-1:1 | OV | 11 | 0.0276402 | noncoding | 79 | chr17 | 46830591 | 46833242 | - | 0.9185 | lnc-WNT3-1 | 0.422 | -4.621 | -1.433 | -2.977 | 2 | noncoding | -0.347013984 | GPVPTMASVTR | n[145]GPVPTM[147]ASVTR | LTSLWIGSQGHELVLSTTLPLFLLFPGCVVDSSGTQQSLRCRDSPQVPRHSLKGPVPTMASVTRTRSQNAGFWDLSAPF |
lnc-WNT4-1:5 | CCRC | 12 | 0.133395 | noncoding | 51 | chr1 | 22410974 | 22418964 | - | 0.9959 | lnc-WNT4-1 | 0.301 | -4.541 | -4.126 | -3.808 | 360 | noncoding | -0.335008802 | HGAGVSVSEMGR | n[230]HGAGVSVSEMGR | LCKHGAGVSVSEMGRGLQALSDQLPSAASQQMYLSLLGKKDLQQRWGAESP |
lnc-WNT4-1:5 | CCRC | 12 | 0.133395 | noncoding | 51 | chr1 | 22410974 | 22418964 | - | 0.9959 | lnc-WNT4-1 | 0.301 | -4.541 | -4.126 | -3.808 | 360 | noncoding | -0.335008802 | HGAGVSVSEMGR | n[230]HGAGVSVSEM[147]GR | LCKHGAGVSVSEMGRGLQALSDQLPSAASQQMYLSLLGKKDLQQRWGAESP |
lnc-WNT4-6:1 | HCC | 7 | 0.325917 | noncoding | 80 | chr1 | 22364629 | 22366482 | - | 0.9984 | lnc-WNT4-6 | 0.702 | 0 | 0 | 0 | 37 | noncoding | -0.343431106 | KVPEGGK | KVPEGGK | LVGNTAKPCQTGKAGMGEGASLGEAIVQCHGKRPPAVSVLKHHRALMDGRTQVCGGTGGWGTWDRATWAGRKVPEGGKVA |
Page 1 of 1
bottom of page