top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-WSB1-6:1 | OV | 7 | 0.0125374 | noncoding | 84 | chr17 | 27281093 | 27281415 | + | 0.9257 | lnc-WSB1-6 | 0.293 | 0 | 0 | 0 | 3 | noncoding | -0.331094707 | AAGLVSK | n[145]AAGLVSK | LNEVGTVNDLLKYEKKFPSEKAAGLVSKSLQFENTSCLVWSKYNDVLQGISLPKGAAIQKGVKDKPTNPTGLYTWLRALPASGL |
lnc-WSB1-6:1 | OV | 12 | 0.0125374 | noncoding | 84 | chr17 | 27281093 | 27281415 | + | 0.7378 | lnc-WSB1-6 | 0.293 | 0 | 0 | 0 | 1 | noncoding | -0.331094707 | YNDVLQGISLPK | n[145]YNDVLQGISLPK | LNEVGTVNDLLKYEKKFPSEKAAGLVSKSLQFENTSCLVWSKYNDVLQGISLPKGAAIQKGVKDKPTNPTGLYTWLRALPASGL |
lnc-WSCD1-1:1 | OV | 16 | 0.0144102 | noncoding | 106 | chr17 | 5772228 | 5774217 | + | 0.7447 | lnc-WSCD1-1 | 1 | -2.859 | -4.192 | -1.498 | 3 | noncoding | -0.304375314 | GGQAGLGMLEAGALSR | n[145]GGQAGLGMLEAGALSR | LAVITKTQLLGISTPPTSLQGSPSILGNPLARSAVIFARLPLLPQVADCLLTEKKVTERCLCWQRGGQAGLGMLEAGALSRGWCYPRPGGIRTCKSAVKTGKCCEL |
lnc-WWC2-2:1 | EOGC | 10 | 0.168256 | noncoding | 40 | chr4 | 183097456 | 183098030 | + | 0.9974 | lnc-WWC2-2 | 0.217 | 0 | 0 | -4.138 | 22 | noncoding | -0.346407592 | LSLSTFEIGR | n[145]LSLSTFEIGR | LSLSTFEIGRRCPDGMAWGAESCPQPRTATAHAAQASLTQ |
lnc-WWP1-3:1 | EOGC | 19 | 0.111957 | noncoding | 77 | chr8 | 86043101 | 86043507 | + | 0.0711 | lnc-WWP1-3 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.328003926 | GPPSWPSESPTTMPGCAAK | n[145]GPPSWPSESPTTMPGCAAK | LVMGATKKHKAHAADGFRKFLVHNAKELEVLLMCNKSYFAEITHNVSFQNRKATWKGPPSWPSESPTTMPGCAAKKM |
Page 1 of 1
bottom of page