top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-XIRP2-2:2 | OV | 7 | 0.0368596 | noncoding | 36 | chr2 | 167536958 | 167538972 | + | 0.9814 | lnc-XIRP2-2 | 0.039 | 0 | 0 | 0 | 1 | noncoding | -0.383872984 | SYLMAGR | n[145]SYLMAGR | MSSSVRSYLMAGRRACAGKLPFIKPSGLMRLIHSLP |
lnc-XIRP2-2:2 | OV | 13 | 0.0368596 | noncoding | 36 | chr2 | 167536958 | 167538972 | + | 0.1055 | lnc-XIRP2-2 | 0.039 | 0 | 0 | 0 | 1 | noncoding | -0.383872984 | SYLMAGRRACAGK | n[145]SYLM[147]AGRRACAGK | MSSSVRSYLMAGRRACAGKLPFIKPSGLMRLIHSLP |
lnc-XKR6-1:1 | CCRC | 11 | 0.0509804 | noncoding | 107 | chr8 | 10893496 | 10896846 | - | 0.0776 | lnc-XKR6-1 | 0.541 | -5.294 | -1.789 | -5.271 | 1 | noncoding | -0.360704835 | TLTQADLRPER | n[230]TLTQADLRPER | LSQQHGYQDTGRTLTQADLRPERKRRHLPCPDMPPSQHSLGQGRRHFPMAWGSPTPHLPRHRIIQDPMVLMALTQSLPSRGPSESHDPVWPVVMKVIPLARGHLMPQ |
lnc-XKR6-1:1 | CCRC | 12 | 0.0509804 | noncoding | 107 | chr8 | 10893496 | 10896846 | - | 0.9958 | lnc-XKR6-1 | 0.541 | -5.294 | -1.789 | -5.271 | 1 | noncoding | -0.360704835 | TLTQADLRPERK | n[230]TLTQADLRPERK | LSQQHGYQDTGRTLTQADLRPERKRRHLPCPDMPPSQHSLGQGRRHFPMAWGSPTPHLPRHRIIQDPMVLMALTQSLPSRGPSESHDPVWPVVMKVIPLARGHLMPQ |
lnc-XKR6-3:2 | BRCA-Luminal B | 12 | 0.0794019 | noncoding | 50 | chr8 | 11178697 | 11347500 | - | 0.9996 | lnc-XKR6-3 | 0.238 | 0 | 0 | 0 | 1 | coding | 0.65559701 | LVTWETLALQKK | n[145]LVTWETLALQKK | LVTWETLALQKKKKKKKKKISQVWSCMPVVLATWEAEAGRLFELGRPRLQ |
Page 1 of 1
bottom of page