top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZC3H12C-5:2 | BRCA-Basal-like | 13 | 0.221312 | noncoding | 43 | chr11 | 110022786 | 110084408 | + | 1 | lnc-ZC3H12C-5 | 0.996 | -4.057 | -4.354 | -5.772 | 35 | noncoding | -0.345555202 | VIAGTEAIFILQK | n[145]VIAGTEAIFILQK | LDAFPSHFEPRAHDQRRRNLKESILARVIAGTEAIFILQKQQA |
lnc-YBEY-6:1 | BRCA-Basal-like | 12 | 0.102297 | noncoding | 33 | chr21 | 46229230 | 46235165 | + | 0.9958 | lnc-YBEY-6 | 0.938 | 0 | 0 | 0 | 14 | noncoding | -0.284160665 | LVETRGLAMLPR | n[145]LVETRGLAM[147]LPR | LVETRGLAMLPRMVSNSWPQGILPLQPPKVLGL |
lnc-YBEY-6:1 | BRCA-HER2-enriched | 12 | 0.102297 | noncoding | 33 | chr21 | 46229230 | 46235165 | + | 0.9958 | lnc-YBEY-6 | 0.938 | 0 | 0 | 0 | 14 | noncoding | -0.284160665 | LVETRGLAMLPR | n[145]LVETRGLAM[147]LPR | LVETRGLAMLPRMVSNSWPQGILPLQPPKVLGL |
lnc-YBEY-6:1 | BRCA-Luminal B | 12 | 0.102297 | noncoding | 33 | chr21 | 46229230 | 46235165 | + | 0.9958 | lnc-YBEY-6 | 0.938 | 0 | 0 | 0 | 14 | noncoding | -0.284160665 | LVETRGLAMLPR | n[145]LVETRGLAM[147]LPR | LVETRGLAMLPRMVSNSWPQGILPLQPPKVLGL |
lnc-YBEY-6:1 | BRCA-Luminal A | 12 | 0.102297 | noncoding | 33 | chr21 | 46229230 | 46235165 | + | 0.9958 | lnc-YBEY-6 | 0.938 | 0 | 0 | 0 | 14 | noncoding | -0.284160665 | LVETRGLAMLPR | n[145]LVETRGLAM[147]LPR | LVETRGLAMLPRMVSNSWPQGILPLQPPKVLGL |
Page 1 of 1
bottom of page