top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZBTB2-7:1 | BRCA-HER2-enriched | 7 | 0.514567 | coding | 38 | chr6 | 150839631 | 150865601 | - | 0.9968 | lnc-ZBTB2-7 | 0 | 0 | 0 | 0 | 1 | noncoding | -0.315216551 | SLVPLAK | n[145]SLVPLAK | MGCIRSLLRSLVPLAKIRPRYLTCCRQSWAFDLDTLYP |
lnc-ZBTB2-7:1 | BRCA-HER2-enriched | 8 | 0.514567 | coding | 80 | chr6 | 150839631 | 150865601 | - | 0.9998 | lnc-ZBTB2-7 | 0.503 | 0 | 0 | 0 | 39 | noncoding | -0.315216551 | TPFNTSVK | n[145]TPFNTSVK | MNLLDLFRTPFNTSVKIWMDGEASYSWSMDTGIHMASLALTGRIQCCQLKVESMQVNNLQFSQVIVWESGLITIFPTTSI |
lnc-ZBTB2-7:1 | BRCA-Luminal B | 8 | 0.514567 | coding | 80 | chr6 | 150839631 | 150865601 | - | 0.9998 | lnc-ZBTB2-7 | 0.503 | 0 | 0 | 0 | 39 | noncoding | -0.315216551 | TPFNTSVK | n[145]TPFNTSVK | MNLLDLFRTPFNTSVKIWMDGEASYSWSMDTGIHMASLALTGRIQCCQLKVESMQVNNLQFSQVIVWESGLITIFPTTSI |
lnc-ZBTB2-7:1 | BRCA-Basal-like | 8 | 0.514567 | coding | 80 | chr6 | 150839631 | 150865601 | - | 0.9998 | lnc-ZBTB2-7 | 0.503 | 0 | 0 | 0 | 39 | noncoding | -0.315216551 | TPFNTSVK | n[145]TPFNTSVK | MNLLDLFRTPFNTSVKIWMDGEASYSWSMDTGIHMASLALTGRIQCCQLKVESMQVNNLQFSQVIVWESGLITIFPTTSI |
lnc-ZBTB2-7:1 | BRCA-Luminal A | 8 | 0.514567 | coding | 80 | chr6 | 150839631 | 150865601 | - | 0.9998 | lnc-ZBTB2-7 | 0.503 | 0 | 0 | 0 | 39 | noncoding | -0.315216551 | TPFNTSVK | n[145]TPFNTSVK | MNLLDLFRTPFNTSVKIWMDGEASYSWSMDTGIHMASLALTGRIQCCQLKVESMQVNNLQFSQVIVWESGLITIFPTTSI |
Page 1 of 1
bottom of page