top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZFP36L1-2:13 | OSCC | 12 | 0.0536424 | noncoding | 81 | chr14 | 68625526 | 68628787 | - | 0.8897 | lnc-ZFP36L1-2 | 1 | -2.062 | -0.263 | -1.012 | 5 | noncoding | -0.34442272 | GFGAGMGGIFVR | n[145]GFGAGM[147]GGIFVR | LAPQCAVVPRLPSGRGFGAGMGGIFVRYLKQSRENKAGLCAAGRPGSWEPPAPKHCAGPGECACARRPVRSGSVPAFTPAE |
lnc-ZFP36L1-2:13 | OSCC | 15 | 0.0536424 | noncoding | 81 | chr14 | 68625526 | 68628787 | - | 0.4603 | lnc-ZFP36L1-2 | 1 | -2.062 | -0.263 | -1.012 | 5 | noncoding | -0.34442272 | GFGAGMGGIFVRYLK | n[145]GFGAGMGGIFVRYLK | LAPQCAVVPRLPSGRGFGAGMGGIFVRYLKQSRENKAGLCAAGRPGSWEPPAPKHCAGPGECACARRPVRSGSVPAFTPAE |
lnc-ZFP36L1-2:13 | OV | 18 | 0.0536424 | noncoding | 81 | chr14 | 68625526 | 68628787 | - | 0.7605 | lnc-ZFP36L1-2 | 1 | -2.062 | -0.263 | -1.012 | 14 | noncoding | -0.34442272 | AGLCAAGRPGSWEPPAPK | n[145]AGLCAAGRPGSWEPPAPK | LAPQCAVVPRLPSGRGFGAGMGGIFVRYLKQSRENKAGLCAAGRPGSWEPPAPKHCAGPGECACARRPVRSGSVPAFTPAE |
lnc-ZFP36L1-2:13 | OV | 12 | 0.0536424 | noncoding | 81 | chr14 | 68625526 | 68628787 | - | 0.9955 | lnc-ZFP36L1-2 | 1 | -2.062 | -0.263 | -1.012 | 3 | noncoding | -0.34442272 | GFGAGMGGIFVR | n[145]GFGAGM[147]GGIFVR | LAPQCAVVPRLPSGRGFGAGMGGIFVRYLKQSRENKAGLCAAGRPGSWEPPAPKHCAGPGECACARRPVRSGSVPAFTPAE |
lnc-ZFP36L1-6:1 | HCC | 11 | 0.136841 | noncoding | 67 | chr14 | 68887784 | 68888084 | - | 1 | lnc-ZFP36L1-6 | 1 | 0 | 0 | 0 | 35 | noncoding | -0.360529624 | GKVSSAEGAAK | GKVSSAEGAAK | MPKGKVSSAEGAAKEKPKRRSARLSVKPPAKVEAKPKNAAVKDKSSDKKVQTKGKKGAKGKQAEVAN |
Page 1 of 1
bottom of page