top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TTTY15:1 | EOGC | 10 | 0.00605421 | noncoding | 39 | chrY | 12662333 | 12690441 | + | 0.9998 | TTTY15 | 0.614 | 0 | 0 | 0 | 25 | noncoding | -0.347757933 | LVLVSGPGDR | n[145]LVLVSGPGDR | LPLSYLGRLPERLVLVSGPGDRSVSGETWPKTARKKSEA |
TUG1:24 | CCRC | 8 | 0.310205 | noncoding | 33 | chr22 | 30971366 | 30978845 | + | 0.9977 | TUG1 | 1 | -4.065 | -5.056 | -4.78 | 8 | noncoding | -0.36772923 | LYQFNLAK | n[43]LYQFNLAK | LYQFNLAKEEKFPLYLKFTADSNCLTELFDVEG |
TUG1:48 | OV | 21 | 0.824636 | coding | 77 | chr22 | 30969489 | 30979405 | + | 0.3529 | TUG1 | 1 | 2.525 | -1.56 | 9.857 | 8 | coding | 0.638967876 | TQLGGQEGAGGWAETDNLTSR | n[145]TQLGGQEGAGGWAETDNLTSR | LLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRHPSGPARTQLGGQEGAGGWAETDNLTSREMTWRKKSVGLFALL |
TUSC8:10 | OV | 17 | 0.0928486 | noncoding | 44 | chr13 | 44397724 | 44405973 | - | 0.4649 | TUSC8 | 0.015 | -4.094 | -5.433 | -2.723 | 4 | noncoding | -0.304606504 | ASIGGLGGMLVWALREK | n[145]ASIGGLGGM[147]LVWALREK | MASIGGLGGMLVWALREKEKVCTLIKSRQCGSWKETHGNTDPVT |
TUSC8:10 | OV | 17 | 0.0928486 | noncoding | 44 | chr13 | 44397724 | 44405973 | - | 0.4649 | TUSC8 | 0.015 | -4.094 | -5.433 | -2.723 | 4 | noncoding | -0.304606504 | ASIGGLGGMLVWALREK | n[145]ASIGGLGGMLVWALREK | MASIGGLGGMLVWALREKEKVCTLIKSRQCGSWKETHGNTDPVT |
Page 1 of 1
bottom of page