top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZNF680-29:1 | LUAD | 7 | 0.0796924 | noncoding | 85 | chr7 | 63937904 | 63938509 | - | 0.9051 | lnc-ZNF680-29 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.397139474 | SGSFCHR | n[230]SGSFCHR | MVGCDSLSLDLRKISSNCPKPCGTCCLTASSSSKRSGSFCHRLWPQFFCCEGHSPRLREIPLNLPFIKPKLMSCLPAYSAQAVLS |
lnc-ZNF680-32:4 | BRCA-Luminal B | 10 | 0.0465805 | noncoding | 36 | chr7 | 63923673 | 63925715 | - | 0.9948 | lnc-ZNF680-32 | 0.475 | 0 | 0 | 0 | 2 | noncoding | -0.371007169 | LSDINIGQPK | n[145]LSDINIGQPK | LSDINIGQPKSLLLIICMKYLFFSFHFQPVVSFSLM |
lnc-ZNF680-32:4 | BRCA-Basal-like | 10 | 0.0465805 | noncoding | 36 | chr7 | 63923673 | 63925715 | - | 0.9948 | lnc-ZNF680-32 | 0.475 | 0 | 0 | 0 | 2 | noncoding | -0.371007169 | LSDINIGQPK | n[145]LSDINIGQPK | LSDINIGQPKSLLLIICMKYLFFSFHFQPVVSFSLM |
lnc-ZNF680-32:4 | BRCA-Luminal B | 21 | 0.0465805 | noncoding | 68 | chr7 | 63923673 | 63925715 | - | 0.9976 | lnc-ZNF680-32 | 0.445 | 0 | 0 | 0 | 47 | noncoding | -0.371007169 | MHLLDPGLAAWPASGSGLAHR | n[145]MHLLDPGLAAWPASGSGLAHR | MHLLDPGLAAWPASGSGLAHRRSCHCDKEEKMSQEKGTFCEPHPPLLCPPTQAGSQAPGSWCGPACRN |
lnc-ZNF680-32:4 | BRCA-Basal-like | 21 | 0.0465805 | noncoding | 68 | chr7 | 63923673 | 63925715 | - | 0.9976 | lnc-ZNF680-32 | 0.445 | 0 | 0 | 0 | 47 | noncoding | -0.371007169 | MHLLDPGLAAWPASGSGLAHR | n[145]MHLLDPGLAAWPASGSGLAHR | MHLLDPGLAAWPASGSGLAHRRSCHCDKEEKMSQEKGTFCEPHPPLLCPPTQAGSQAPGSWCGPACRN |
Page 1 of 1
bottom of page