top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZNF804A-3:3 | OSCC | 7 | 0.185809 | noncoding | 51 | chr2 | 183997292 | 184392434 | + | 0.9977 | lnc-ZNF804A-3 | 0.794 | -5.429 | -5.417 | -5.805 | 1 | noncoding | -0.380206172 | YNILGTK | n[145]YNILGTK | LRLETAQSLTDCKTQKYNILGTKGKHNDTEGNIEVPKLGILDFRPSVPLTA |
lnc-ZNF804B-1:1 | OV | 11 | 0.0452565 | noncoding | 79 | chr7 | 88710630 | 88756725 | + | 0.707 | lnc-ZNF804B-1 | 0.232 | 0 | 0 | 0 | 6 | noncoding | -0.429429831 | LKPTQDWVLSK | n[145]LKPTQDWVLSK | LKPTQDWVLSKACGNHCLVTTYVHSRRSLSTYPPQLGLCWVISEASTHLSLIQGPHLVRKIHIVTRKRWRKKRKQKKMY |
lnc-ZNF81-1:2 | OSCC | 20 | 0.0287414 | noncoding | 33 | chrX | 47707255 | 47753456 | + | 0.989 | lnc-ZNF81-1 | 0.776 | 0 | 0 | 0 | 12 | noncoding | -0.412971662 | GLQMANDLSNYSLNLVHIQK | n[145]GLQMANDLSNYSLNLVHIQK | MGLQMANDLSNYSLNLVHIQKERNCASEAVCNG |
lnc-ZNF81-1:3 | BRCA-Luminal B | 15 | 0.976487 | coding | 64 | chrX | 47722330 | 47725932 | + | 0.9999 | lnc-ZNF81-1 | 1 | -3.536 | -4.56 | -4.814 | 167 | noncoding | -0.272928831 | LDTGHLTAASNAEVR | n[145]LDTGHLTAASNAEVR | LDTGHLTAASNAEVRASPEVPDGSGATGSKGGTWATATPQLLSEEDLPWHCDLYQDTCRGDFLG |
lnc-ZNF81-1:3 | BRCA-Luminal A | 15 | 0.976487 | coding | 64 | chrX | 47722330 | 47725932 | + | 0.9999 | lnc-ZNF81-1 | 1 | -3.536 | -4.56 | -4.814 | 167 | noncoding | -0.272928831 | LDTGHLTAASNAEVR | n[145]LDTGHLTAASNAEVR | LDTGHLTAASNAEVRASPEVPDGSGATGSKGGTWATATPQLLSEEDLPWHCDLYQDTCRGDFLG |
Page 1 of 1
bottom of page