top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZNF827-2:1 | CCRC | 10 | 0.0414147 | noncoding | 36 | chr4 | 146052603 | 146056762 | - | 0.9728 | lnc-ZNF827-2 | 0.078 | -5.212 | -4.675 | -5.374 | 1 | noncoding | -0.380789401 | GSLQEELNYR | n[230]GSLQEELNYR | LGESEETPISCNQRAGCSKKMTFRGSLQEELNYRAD |
lnc-ZNF827-2:1 | CCRC | 14 | 0.0414147 | noncoding | 36 | chr4 | 146052603 | 146056762 | - | 0.996 | lnc-ZNF827-2 | 0.078 | -5.212 | -4.675 | -5.374 | 3 | noncoding | -0.380789401 | LGESEETPISCNQR | n[230]LGESEETPISCNQR | LGESEETPISCNQRAGCSKKMTFRGSLQEELNYRAD |
lnc-ZNF827-2:1 | OV | 14 | 0.0414147 | noncoding | 65 | chr4 | 146052603 | 146056762 | - | 0.4922 | lnc-ZNF827-2 | 0.142 | -5.446 | -4.972 | -5.058 | 1 | noncoding | -0.380789401 | LVGSSEVPNGIEPK | n[145]LVGSSEVPNGIEPK | LVGSSEVPNGIEPKLPTVKTHSPTQFSFHPSQFAHSLTCSTWDTLQDKLLYPKLCLKVSFGRNSN |
lnc-ZNF827-2:1 | OV | 29 | 0.0414147 | noncoding | 65 | chr4 | 146052603 | 146056762 | - | 0.5088 | lnc-ZNF827-2 | 0.142 | -5.446 | -4.972 | -5.058 | 4 | noncoding | -0.380789401 | THSPTQFSFHPSQFAHSLTCSTWDTLQDK | n[145]THSPTQFSFHPSQFAHSLTCSTWDTLQDK | LVGSSEVPNGIEPKLPTVKTHSPTQFSFHPSQFAHSLTCSTWDTLQDKLLYPKLCLKVSFGRNSN |
lnc-ZNF83-4:1 | CCRC | 13 | 0.104422 | noncoding | 88 | chr19 | 52575882 | 52585561 | - | 0.1091 | lnc-ZNF83-4 | 0.361 | 0 | 0 | 0 | 1 | noncoding | -0.292699722 | GGVCRIPGPGRGR | n[230]GGVCRIPGPGRGR | MFNIHLPGNFTFQACLPGTTGRGWKKRVASRRSTFSWGWNWGEAGPARGGRWWAMAPSDRGGVCRIPGPGRGRGLPGSGAAALPSRRR |
Page 1 of 1
bottom of page