top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
lnc-ZNF98-3:1 | EOGC | 8 | 0.330556 | noncoding | 117 | chr19 | 22368598 | 22368952 | - | 0.4785 | lnc-ZNF98-3 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.435929178 | AFLIGEQK | n[145]AFLIGEQK | MVQRLTYQCRLSYNTASNKTRLPRTPGNRIVYLYTKKVGKAPRSASGMCPGRLRGVRAVRPKVLMKLSKRKKHVSRAYGGSMCAKCVRGRIKRAFLIGEQKIVVKVLKAQVQSHKAK |
lnc-ZNF98-3:1 | EOGC | 9 | 0.330556 | noncoding | 117 | chr19 | 22368598 | 22368952 | - | 0.7668 | lnc-ZNF98-3 | 1 | 0 | 0 | 0 | 5 | noncoding | -0.435929178 | SASGMCPGR | n[145]SASGM[147]CPGR | MVQRLTYQCRLSYNTASNKTRLPRTPGNRIVYLYTKKVGKAPRSASGMCPGRLRGVRAVRPKVLMKLSKRKKHVSRAYGGSMCAKCVRGRIKRAFLIGEQKIVVKVLKAQVQSHKAK |
lnc-ZNF99-2:2 | CRC | 8 | 0.283505 | noncoding | 34 | chr19 | 22520994 | 22527949 | - | 0.653 | lnc-ZNF99-2 | 1 | 0 | 0 | 0 | 1 | noncoding | -0.34325413 | LVFLEERK | LVFLEERKRKFKMAVTLRQPLLVVATHLGIFRTF | |
lnc-ZNF99-2:2 | HCC | 8 | 0.283505 | noncoding | 61 | chr19 | 22520994 | 22527949 | - | 1 | lnc-ZNF99-2 | 1 | 0 | 0 | 0 | 21 | noncoding | -0.34325413 | LAGGAGQR | n[230]LAGGAGQR | LLLRLAGGAGQRHGRCPYALPSIFSIFFQFFFSFSFPFLHFYFFLFFALLLALVPAPSFSR |
lnc-ZNF99-5:1 | PRAD | 19 | 0.0208036 | noncoding | 89 | chr19 | 22708833 | 22709314 | - | 0.0965 | lnc-ZNF99-5 | 1 | 0 | 0 | 0 | 2 | noncoding | -0.290479987 | GAGAALQAGGGDSHAWFLK | LAPQAERTRPGNALVGLGFLRTELGLDAGLQLRRSWARRPRAWALRLLLRFLLCSAGPRLEPAPVRGAGAALQAGGGDSHAWFLKIWPC |
Page 1 of 1
bottom of page