top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
LY86-AS1:4 | HCC | 11 | 0.0680266 | noncoding | 35 | chr6 | 6346464 | 6622744 | - | 0.1222 | LY86-AS1 | 0.994 | 0 | 0 | 0 | 2 | noncoding | -0.334333763 | LGHVASSSVTR | n[272]LGHVASSSVTR | LGHVASSSVTRKHAELGQELRKEEETLLLLKAALA |
LY86-AS1:4 | LUAD | 9 | 0.0680266 | noncoding | 35 | chr6 | 6346464 | 6622744 | - | 0.9997 | LY86-AS1 | 0.994 | 0 | 0 | 0 | 3 | noncoding | -0.334333763 | EEETLLLLK | n[230]EEETLLLLK | LGHVASSSVTRKHAELGQELRKEEETLLLLKAALA |
LY86-AS1:4 | LUAD | 9 | 0.0680266 | noncoding | 35 | chr6 | 6346464 | 6622744 | - | 0.9515 | LY86-AS1 | 0.994 | 0 | 0 | 0 | 2 | noncoding | -0.334333763 | HAELGQELR | n[230]HAELGQELR | LGHVASSSVTRKHAELGQELRKEEETLLLLKAALA |
LY86-AS1:4 | LUAD | 10 | 0.0680266 | noncoding | 35 | chr6 | 6346464 | 6622744 | - | 0.9995 | LY86-AS1 | 0.994 | 0 | 0 | 0 | 47 | noncoding | -0.334333763 | KEEETLLLLK | n[230]KEEETLLLLK | LGHVASSSVTRKHAELGQELRKEEETLLLLKAALA |
LY86-AS1:4 | OV | 20 | 0.0680266 | noncoding | 73 | chr6 | 6346464 | 6622744 | - | 0.8886 | LY86-AS1 | 0.994 | 0 | 0 | 0 | 10 | noncoding | -0.334333763 | AGSGTAQGGGDTAPVEGSPR | n[145]AGSGTAQGGGDTAPVEGSPR | LRVKELILIQLLTPKKTVTLVIKMGRVHQEAVSRSTGPCGEQQCHQETCRAGSGTAQGGGDTAPVEGSPRMTC |
Page 1 of 1
bottom of page