top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
LY86-AS1:12 | BRCA-Basal-like | 8 | 0.0855651 | noncoding | 34 | chr6 | 6346103 | 6362467 | - | 0.999 | LY86-AS1 | 0.123 | -6.043 | -6.675 | -5.768 | 32 | noncoding | -0.330729493 | DVNIQEMR | n[145]DVNIQEMR | LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC |
LY86-AS1:12 | BRCA-Luminal B | 8 | 0.0855651 | noncoding | 34 | chr6 | 6346103 | 6362467 | - | 0.999 | LY86-AS1 | 0.123 | -6.043 | -6.675 | -5.768 | 32 | noncoding | -0.330729493 | DVNIQEMR | n[145]DVNIQEM[147]R | LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC |
LY86-AS1:12 | BRCA-Luminal A | 8 | 0.0855651 | noncoding | 34 | chr6 | 6346103 | 6362467 | - | 0.999 | LY86-AS1 | 0.123 | -6.043 | -6.675 | -5.768 | 32 | noncoding | -0.330729493 | DVNIQEMR | n[145]DVNIQEM[147]R | LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC |
LY86-AS1:12 | BRCA-HER2-enriched | 8 | 0.0855651 | noncoding | 34 | chr6 | 6346103 | 6362467 | - | 0.999 | LY86-AS1 | 0.123 | -6.043 | -6.675 | -5.768 | 32 | noncoding | -0.330729493 | DVNIQEMR | n[145]DVNIQEM[147]R | LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC |
LY86-AS1:12 | BRCA-Basal-like | 8 | 0.0855651 | noncoding | 34 | chr6 | 6346103 | 6362467 | - | 0.999 | LY86-AS1 | 0.123 | -6.043 | -6.675 | -5.768 | 32 | noncoding | -0.330729493 | DVNIQEMR | n[145]DVNIQEM[147]R | LLLPCVCLKVDIVMQGRDVNIQEMRSLKGLPSRC |
Page 1 of 1
bottom of page