top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MAMDC2-AS1:19 | OSCC | 9 | 0.0185506 | noncoding | 45 | chr9 | 70033920 | 70088424 | - | 0.9254 | MAMDC2-AS1 | 0.999 | -4.197 | -5.291 | -5.732 | 2 | noncoding | -0.407203493 | VSFIFIGNK | n[145]VSFIFIGNK | LFCPGRVSFIFIGNKIITVRKAQTIGDNEETLLPDVAGCLNDLIQ |
MANCR:22 | OV | 10 | 0.0897275 | noncoding | 69 | chr10 | 4581142 | 4678222 | - | 0.9875 | MANCR | 0.342 | -3.81 | -4.818 | -4.737 | 3 | coding | 0.529455997 | IFIPKEDFQK | n[145]IFIPKEDFQK | LLSDLAYREELTQTSLDVLSSCHWCIPYQCESKILIKLSSIYARKIFIPKEDFQKMTHEGHSSQSSLLF |
MANCR:25 | CCRC | 12 | 0.0746807 | noncoding | 56 | chr10 | 4631124 | 4678214 | - | 0.0736 | MANCR | 0.009 | -4.766 | -4.346 | -4.731 | 1 | noncoding | -0.379677224 | LSVSGCLSINLK | n[230]LSVSGCLSINLK | LQKVKMSIYLWPRKKRKLSVSGCLSINLKSLCIYVNVKAKEEMCQTPWHQADHRIK |
MANCR:25 | CCRC | 9 | 0.0746807 | noncoding | 56 | chr10 | 4631124 | 4678214 | - | 1 | MANCR | 0.009 | -4.766 | -4.346 | -4.731 | 5 | noncoding | -0.379677224 | SLCIYVNVK | SLCIYVNVK | LQKVKMSIYLWPRKKRKLSVSGCLSINLKSLCIYVNVKAKEEMCQTPWHQADHRIK |
MANCR:25 | OV | 11 | 0.0746807 | noncoding | 49 | chr10 | 4631124 | 4678214 | - | 0.9028 | MANCR | 0.01 | -4.506 | -4.032 | -5.602 | 4 | noncoding | -0.379677224 | LNNPMPGTLAK | n[145]LNNPMPGTLAK | LNNPMPGTLAKDKRISVGLLSYPRSGLIMGSVTEEVFMTLSREKHPCLL |
Page 1 of 1
bottom of page