top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MESTIT1:1 | OSCC | 8 | 0.0629567 | noncoding | 49 | chr7 | 130487056 | 130491172 | - | 0.2538 | MESTIT1 | 0.746 | -3.986 | -5.005 | 0 | 1 | noncoding | -0.316044347 | ERQGELLK | n[145]ERQGELLK | MSTHMDQVGRLEEKQFKGPGGRRERQGELLKTTGIPSLALGRNPPFRHY |
MESTIT1:1 | OSCC | 9 | 0.0629567 | noncoding | 49 | chr7 | 130487056 | 130491172 | - | 0.7591 | MESTIT1 | 0.746 | -3.986 | -5.005 | 0 | 8 | noncoding | -0.316044347 | STHMDQVGR | n[145]STHMDQVGR | MSTHMDQVGRLEEKQFKGPGGRRERQGELLKTTGIPSLALGRNPPFRHY |
MESTIT1:1 | OV | 9 | 0.0629567 | noncoding | 49 | chr7 | 130487056 | 130491172 | - | 0.9102 | MESTIT1 | 0.746 | -3.986 | -5.005 | 0 | 9 | noncoding | -0.316044347 | STHMDQVGR | n[145]STHM[147]DQVGR | MSTHMDQVGRLEEKQFKGPGGRRERQGELLKTTGIPSLALGRNPPFRHY |
MESTIT1:1 | OV | 9 | 0.0629567 | noncoding | 49 | chr7 | 130487056 | 130491172 | - | 0.9102 | MESTIT1 | 0.746 | -3.986 | -5.005 | 0 | 9 | noncoding | -0.316044347 | STHMDQVGR | n[145]STHMDQVGR | MSTHMDQVGRLEEKQFKGPGGRRERQGELLKTTGIPSLALGRNPPFRHY |
MID1IP1-AS1:7 | OSCC | 8 | 0.0997406 | noncoding | 51 | chrX | 38794158 | 38803831 | - | 0.7445 | MID1IP1-AS1 | 0.692 | -5.207 | -5.62 | -5.109 | 1 | coding | 0.606716875 | NPVLGASK | n[145]NPVLGASK | LHKNVCEPNLNGNRKVVSSPNFGPLGQKPLFLLSAPVNCSLRNPVLGASKL |
Page 1 of 1
bottom of page