top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MIR29B2CHG:57 | OV | 10 | 0.962996 | coding | 92 | chr1 | 207818375 | 207869166 | - | 0.9261 | MIR29B2CHG | 0.48 | 0 | 0 | 0 | 17 | noncoding | -0.284115066 | LLVSFLEGER | n[145]LLVSFLEGER | LLVSFLEGERAALGDVLLLLLLLLFETESRSVTQAGVQWHDVGSLQPLPPGFKRFSCLSLPSSWDYRRPPPCPANFCIFSRDRVSPCWSGWS |
MIR29B2CHG:57 | OV | 15 | 0.962996 | coding | 47 | chr1 | 207818375 | 207869166 | - | 0.827 | MIR29B2CHG | 0.69 | -4.417 | -4.885 | -5.384 | 1 | noncoding | -0.284115066 | MLFLYQFLLILFILR | n[145]MLFLYQFLLILFILR | MLFLYQFLLILFILRSPGWSSLLRLCMSTSSWLLTIGPSVYFPKPYL |
MIR29B2CHG:57 | PRAD | 7 | 0.962996 | coding | 40 | chr1 | 207818375 | 207869166 | - | 0.9952 | MIR29B2CHG | 0.013 | -2.647 | -5.484 | -4.511 | 1 | noncoding | -0.284115066 | RVGAIVR | LGIAEGHQNCEELTSGREGKSGRRVGAIVRGNMETSSGLG | |
MIR29B2CHG:61 | EOGC | 12 | 0.243625 | noncoding | 35 | chr1 | 207801517 | 207869150 | - | 0.9975 | MIR29B2CHG | 0.017 | -3.257 | -4.424 | -4.121 | 28 | noncoding | -0.299892843 | LLLCTEPLLCAR | n[145]LLLCTEPLLCAR | MPFGSHGQAELSKASTWRLLLCTEPLLCARDCARR |
MIR29B2CHG:81 | OV | 11 | 0.236428 | noncoding | 56 | chr1 | 207795490 | 207823912 | - | 0.4934 | MIR29B2CHG | 1 | -2.918 | -2.024 | 1.326 | 1 | noncoding | -0.325047433 | LFLIGSGQGIK | n[145]LFLIGSGQGIK | LVGGPMAGEKLFLIGSGQGIKSEFAFHLLKGERGEAQQLSKISLGVCVGSCVYACF |
Page 1 of 1
bottom of page