top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MIR3681HG:34 | OSCC | 14 | 0.0709589 | noncoding | 64 | chr2 | 12326913 | 12327294 | + | 0.6185 | MIR3681HG | 0.114 | -5.542 | -4.656 | -4.469 | 5 | noncoding | -0.36812552 | FDSAYLRPGTDSLR | n[145]FDSAYLRPGTDSLR | LNELGMAPPSGSKDGGGKGTWRGEQGKFDSAYLRPGTDSLRSSEQWQRRAPLFSPAGCSQLCLE |
MIR3936HG:16 | OV | 7 | 0.0449187 | noncoding | 92 | chr5 | 132364221 | 132369648 | - | 0.7982 | MIR3936HG | 0.025 | -1.425 | -3.801 | -4.359 | 3 | noncoding | -0.342589588 | AYLGAER | n[145]AYLGAER | LARPGLCQPSLLGTTEVARARLRKAAGLEALGSESELAPLAPGGERVGERPRSSSVENAPLPAFCKAYLGAERQASCHVISSPLRGPCDVKE |
MIR3936HG:16 | OV | 21 | 0.0449187 | noncoding | 92 | chr5 | 132364221 | 132369648 | - | 0.1524 | MIR3936HG | 0.025 | -1.425 | -3.801 | -4.359 | 1 | noncoding | -0.342589588 | SSSVENAPLPAFCKAYLGAER | n[145]SSSVENAPLPAFCKAYLGAER | LARPGLCQPSLLGTTEVARARLRKAAGLEALGSESELAPLAPGGERVGERPRSSSVENAPLPAFCKAYLGAERQASCHVISSPLRGPCDVKE |
MIR3945HG:4 | LUAD | 9 | 0.16985 | noncoding | 82 | chr4 | 184843345 | 184853545 | - | 0.9973 | MIR3945HG | 0.379 | 0 | 0 | 0 | 5 | noncoding | -0.340769796 | EPSSTASSR | n[230]EPSSTASSR | LICVMMAPLSSGCHCWHFGQGGLGFCSGAVCPRFTPHYFTAHWSSQQSPKVWRSPMGRREGRGLDIREPSSTASSRSRLSST |
MIR193BHG:15 | OSCC | 12 | 0.114095 | noncoding | 34 | chr16 | 14301383 | 14336038 | + | 0.5423 | MIR193BHG | 0.943 | -5.45 | -4.741 | -4.827 | 1 | noncoding | -0.32200154 | MPQQGQEISAAR | n[145]MPQQGQEISAAR | MPQQGQEISAARRLKSSPDHFPNEETVAQRSQVT |
Page 1 of 1
bottom of page