top of page
lncRNA Peptides
Use criteria below to search among 19,871 unique lncRNA peptides:
*Click Transcript to view full ORF and comprehensive information in new page.
Transcript* | Cancer | Peptide Length | CPC Coding Probability | CPC Label | ORF Length | Chromosome | Start | End | Strand | Max Probability | Gene Name | Conservation Score | PhyloCSF Frame 1 | PhyloCSF Frame 2 | PhyloCSF Frame 3 | No. of Spectra | CNTI Index | CNTI Score | Peptide | Modified Peptide | ORF |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
MIR31HG:14 | OV | 7 | 0.309954 | noncoding | 41 | chr9 | 21444226 | 21559855 | - | 0.5445 | MIR31HG | 0.087 | -5 | -5.517 | -5.94 | 1 | noncoding | -0.295575968 | EDMSCLK | n[145]EDMSCLK | LGGCIGWRQGTPPAPFSPQSCPLSKEDMSCLKLGVYPLSKT |
MIR31HG:14 | OV | 17 | 0.309954 | noncoding | 41 | chr9 | 21444226 | 21559855 | - | 0.4037 | MIR31HG | 0.087 | -5 | -5.517 | -5.94 | 3 | noncoding | -0.295575968 | QGTPPAPFSPQSCPLSK | n[145]QGTPPAPFSPQSCPLSK | LGGCIGWRQGTPPAPFSPQSCPLSKEDMSCLKLGVYPLSKT |
MIR31HG:6 | OV | 14 | 0.290361 | noncoding | 45 | chr9 | 21507769 | 21591905 | - | 0.7717 | MIR31HG | 0.84 | 0 | 0 | 0 | 1 | noncoding | -0.323662008 | ITGLQGTLKPNPRK | n[145]ITGLQGTLKPNPRK | LNWAEIAEMTEIKFKIWIGTKITGLQGTLKPNPRKLRITVKQCRS |
MIR31HG:6 | OV | 13 | 0.290361 | noncoding | 45 | chr9 | 21507769 | 21591905 | - | 0.5979 | MIR31HG | 0.84 | 0 | 0 | 0 | 2 | noncoding | -0.323662008 | LNWAEIAEMTEIK | n[145]LNWAEIAEMTEIK | LNWAEIAEMTEIKFKIWIGTKITGLQGTLKPNPRKLRITVKQCRS |
MIR31HG:6 | PRAD | 7 | 0.290361 | noncoding | 70 | chr9 | 21507769 | 21591905 | - | 0.9954 | MIR31HG | 0.411 | 0 | 0 | 0 | 11 | noncoding | -0.323662008 | VLVDPWK | LLCQHVCMGAGFATFVLSVCLCACTLLCHCRSGVALCSFFPCQTTIAVRVLVDPWKISPTPTSTTSLHQH |
Page 1 of 1
bottom of page